[ 1 ]
www.h2020awe.eu
Updated:
(Jul 6, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
27040825 http://www.h2020awe.eu/ text/html; charset=utf-8 Ageing with elegans | Discovering molecular pathways underlying healthy ageing for prevention, diagnosis, and treatment. Discovering molecular...h2020awe.eu/ text/html; charset=utf-8 Ageing with elegans | Discovering molecular pathways underlying healthy ageing for prevention, diagnosis, and treatment. Discovering molecular pathways underlying healthy ageing for prevention, diagnosis, and...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 2 ]
AnAge: The Animal Ageing and Longevity Database
Updated:
(Jul 24, 2009)
Rate Avg:
(
no ratings
)
(
no ratings
)
19522730 http://genomics.senescence.info/species/ text/html; charset=us-ascii AnAge: The Animal Ageing and Longevity DatabaseGenomicsGenAgeA curated database of candidate human ageing-related genes and genes associated with longevity and/or ageing in model organisms.Search humanSearch model organismsGenDRA curated database of genes associated with dietary restriction...or gene expression profiling.Search gene manipulationsSearch gene expressionLongevityMapDatabase of human genetic variants associated with longevity.Search genes/variantsCellAgeDatabase of human genes associated with cellular senescence.Search CellAgeGene ExpressionProjects focused on...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
A database of vertebrate longevity records and their relation to other life-history traits.
(Aug, 2009)
A database of vertebrate longevity records and their relation to other life-history traits.
(Aug, 2009)
[ 3 ]
GenDR: The Dietary Restriction Gene Database
Updated:
(Aug 22, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
22912585 http://genomics.senescence.info/diet/ text/html; charset=us-ascii GenDR: The Dietary Restriction Gene DatabaseGenomicsGenAgeA curated database of candidate human ageing-related genes and genes associated with longevity and/or ageing in model organisms.Search humanSearch model organismsGenDRA curated database of genes associated with dietary restriction...To receive the latest news and announcements, please join the HAGR-news mailing list.Human Ageing Genomic ResourcesHomeAbout UsDisclaimerDownloadsFeedbackHelpLinksMailing ListNewsPublicationsScienceDatabasesGene Database (GenAge)Species Database (AnAge)Dietary Restriction Database (GenDR)Longevity Variants Database (LongevityMap)Cell Senescence Database (CellAge)Drugs Database (DrugAge)External DatabasesDigital Ageing AtlasLibAge (beta version)ProjectsGene ExpressionCancerGenome SequencingEvolution of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 4 ]
GenAge: The Ageing Gene Database
Updated:
(Jul 28, 2004)
Rate Avg:
(
no ratings
)
(
no ratings
)
15280050 http://genomics.senescence.info/genes/ text/html; charset=us-ascii GenAge: The Ageing Gene DatabaseGenomicsGenAgeA curated database of candidate human ageing-related genes and genes associated with longevity and/or ageing in model organisms.Search humanSearch model organismsGenDRA curated database of genes associated with dietary restriction...or gene expression profiling.Search gene manipulationsSearch gene expressionLongevityMapDatabase of human genetic variants associated with longevity.Search genes/variantsCellAgeDatabase of human genes associated with cellular senescence.Search CellAgeGene ExpressionProjects focused on gene expression profiling of ageing and of dietary manipulations of ageing, such as caloric restriction. Genomes Information on developing genomic...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 5 ]
LongevityMap: The Database of Genetic Variants Associated with Longevity
Updated:
(Sep 24, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
23998809 http://genomics.senescence.info/longevity/ text/html; charset=us-ascii LongevityMap: The Database of Genetic Variants Associated with LongevityGenomicsGenAgeA curated database of candidate human ageing-related genes and genes associated with longevity and/or ageing in model organisms.Search humanSearch model organismsGenDRA curated database of genes associated with dietary restriction...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
LongevityMap: a database of human genetic variants associated with longevity.
(Oct, 2013)
LongevityMap: a database of human genetic variants associated with longevity.
(Oct, 2013)
[ 6 ]
MitoAge | Home
Updated:
(Jan 7, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...DNA (mtDNA), together with accumulated data on longevity records, provide new fascinating opportunities for the analysis of the links between mtDNA features and longevity across animals. To facilitate such an analysis...mtDNA data records, and integrated it with longevity records. The MitoAge website also provides the...mtDNA, with a special focus on animal longevity. Why is it important? Mitochondria are the...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 7 ]
The Jackson Laboratory Nathan Shock Center of Excellence in the Basic Biology of Aging
Updated:
(Sep 1, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...of Excellence in the Basic Biology of Aging HomeRESEARCHWithin the CenterEllison ScholarsAt the Jackson LaboratoryPUBLICATIONSCORESAnimal...and Translational Coresperform a comprehensive survey of lifespan and healthspan in the mouse and other...of mouse models for research on biological aging Statistical Coreenables the tracking, statistical analysis and dissemination of aging data Development Coresupports investigators who wish to change career direction towards aging researchAnnouncementsDelayed female sexual maturity linked to longer lifespan in mice, Jackson Laboratory researchers reportMay 7, 2012An intriguing clue to longevity lurks in the sexual maturation timetable of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Identification of fat4 and tsc22d1 as novel candidate genes for spontaneous pulmonary adenomas.
(Sep 1, 2011)
Identification of fat4 and tsc22d1 as novel candidate genes for spontaneous pulmonary adenomas.
(Sep 1, 2011)
[ 8 ]
NetEffects
Updated:
(Dec 19, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Analysing the effects of gene perturbations on longevity via the Insulin Pathway IntroductionPathways represent sequences...and Caenorhabtitis elegans and their role in lifespan. NetEffects provides two different ways of studying each pathway:Querying it by up- or down-regulating specific components.Importing gene expression data and phenotype information (lifespan extension/reduction) and inferring the effects on...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 9 ]
WebCite query result
Updated:
(Apr 28, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...van CCT (UK)The Active and Healthy Aging Study (Dutch: Actief en Gezond Oud Studie...METC LUMC- Public TitleThe Active and Healthy Aging Study (Dutch: Actief en Gezond Oud Studie...Oud Studie).- Scientific TitleThe Active and Healthy Aging Study (Dutch: Actief en Gezond Oud Studie...coaching combined with accelorometry of inactive individuals aged 60-70 years is effective in increasing...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 10 ]
WebCite query result
Updated:
(Dec 9, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...van CCT (UK)The Active and Healthy Aging Study (Dutch: Actief en Gezond Oud Studie...METC LUMC- Public TitleThe Active and Healthy Aging Study (Dutch: Actief en Gezond Oud Studie...Oud Studie).- Scientific TitleThe Active and Healthy Aging Study (Dutch: Actief en Gezond Oud Studie...coaching combined with accelorometry of inactive individuals aged 60-70 years is effective in increasing...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 11 ]
43
Updated:
(Nov 15, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...21st century [4, 5]; they affect all ... groups [6] and their burden is greater...complex gene-environment interactions acting across the lifespan from the fetus to old ... (Figure 1). In this context, 'environment' includes...modulated by socio-economic determinants, psychological factors, ... and gender. The products of these interactions...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 12 ]
NetAge
Updated:
(Jul 8, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...usDownloadSearch: A man ninety years old was asked to what he attributed his longevity. "I reckon," he said, with a twinkle in his eye, "It's because most...microRNA-regulated protein-protein interaction networks which are involved in complex processes of aging and ...-related diseases, and ultimately in the determination of longevity.By making these resources available online, we hope to provide the scientific community...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
The NetAge database: a compendium of networks for longevity, age-related diseases and associated processes.
(Aug, 2010)
The NetAge database: a compendium of networks for longevity, age-related diseases and associated processes.
(Aug, 2010)
[ 13 ]
JenAge Ageing Factor Database
Updated:
(Dec 30, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
24217911 http://agefactdb.jenage.de/ text/html; charset=us-ascii JenAge Ageing Factor Database Research Centre Information Centre AgeFactDBHomeAboutAdvanced SearchBrowseDownloadReleaseHelpContributeContactImprintRelease 1 - Aug 15, 2013 Quick SearchAgeing-related Sources Lifespan Observations Database GenAge GenDR AgeFactDB Curator AgeFactDB Homology Analysis All | NoneAgeing Relevance Evidence Experimental Both Computational Any Result List Type Ageing Factor Observation BrowseAgeing Factors (16599)Genes (16450)Compounds (91)Other Ageing Factors (58)Observations (9611)Ageing Phenotype (8159)Data Type 1 (940...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 14 ]
full
Updated:
(Apr 4, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...for example antioxidant, anti-inflammation and anti-aging, release of neurotransmitter and neuromodulator, modulate mitochondrial...mimic a calorie-restriction diet that extends lifespan and stress resistance by linking to the longevity gene SIRT1. SIRT1 is one member of the mammalian family of Sirtuins, a highly conserved family of NAD+-dependent deacetylases that regulate cellular energy and lifespan in both lower organisms and mammals (Wood...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 15 ]
LIFESPAN | Computer-Aided Design for Longitudinal Studies
Updated:
(Apr 8, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
25852596 http://www.brandmaier.de/lifespan/ text/html; charset=utf-8 LIFESPAN | Computer-Aided Design for Longitudinal StudiesLIFESPANComputer-Aided Design for Longitudinal StudiesMenuSkip to contentHomeInstallationReferencesDownloadsLIFESPAN: Longitudinal Study PlannerThe Longitudinal Interactive Front End Study Planner (LIFESPAN) enables researchers to sketch a longitudinal study...reliability measures for hypotheses about change. Currently, LIFESPAN is limited to latent growth curve models...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 16 ]
FACES 3.3.1 build date 2010-07-20 15:17:02
Updated:
(Feb 17, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...database of facial expressions in younger, middle-aged, and older women and menWhat is FACES?FACES is a set of images of naturalistic faces of 171 younger (n = 58), middle-aged (n = 56), and older (n = 57) women...and Michaela Riediger at the Center for Lifespan Psychology, Max Planck Institute for Human Development...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 17 ]
Regulation of metabolism in Caenorhabditis elegans longevity | Journal of Biology | Full Text
Updated:
(Mar 1, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...1186/jbiol215 text/html; charset=utf-8 Regulation of metabolism in Caenorhabditis elegans longevity | Journal of Biology | Full TextSkip to main contentAdvertisement Login to your account SearchSearch...February 2010AbstractThe nematode Caenorhabditis elegans is a favorite model for the study of aging. A wealth of genetic and genomic studies show that metabolic regulation is a hallmark of life-span modulation. A recent study in BMC Biology identifying metabolic signatures for longevity suggests that amino-acid pools may be important in longevity.See research article http://www.biomedcentral.com/1741-7007/8/14.Aging in...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 18 ]
The Bowhead Whale Genome Resource
Updated:
(Jan 8, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...remain disease-free until much more advanced ages than humans can. Searching the genomeSearchShow search...BLAST search page »The mechanisms for the longevity and resistance to aging-related diseases of bowhead whales are unknown, but it is clear these animals must possess aging prevention mechanisms. In particular in context of cancer, bowhead whales must have anti-tumour mechanisms, because given their large size and longevity, their cells must have a massively lower...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Insights into the evolution of longevity from the bowhead whale genome.
(Jan 6, 2015)
Insights into the evolution of longevity from the bowhead whale genome.
(Jan 6, 2015)
[ 19 ]
www.t2diabetesgenes.org
Updated:
(May 10, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...for: Type 2 Diabetes, Obesity, growth & reproductive ageing geneticsJanuary 26, 2016 rob Leave a commentWe...team also have interests in female reproductive lifespan including ... at Menopause; ii) to use human genetics...Recent PostsType 2 Diabetes, Obesity, growth & reproductive ageing geneticsRecent CommentsArchivesJanuary 2016CategoriesUncategorizedMetaLog inEntries RSSComments RSSWordPress.orgProudly...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 20 ]
Aging.AI | Deep Biomarkers Of Human Aging
Updated:
(Jun 10, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
27191382 http://www.aging.ai/ text/html; charset=utf-8 Aging.AI | Deep Biomarkers Of Human Aging Deep Biomarkers Of Human Aging How old by basic blood testAging.AI...is a deep-learned predictor of your ... made with a deep neural network trained on hundreds of thousands anonymized human blood tests. Enter your data below and Aging.ai will guess your ... and gender First choose the sample metric...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 21 ]
WebCite query result
Updated:
(Aug 7, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...tested with a sample of young adults (ages 18-35) who smoke. Final assessments will... BothAccepts Healthy Volunteers: YesCriteriaInclusion Criteria:... 18 to 35Current daily smokerHas a cell...Beth C Bock, PhD401-793-8020bbock@lifespan.orgLocationsUnited States, Rhode IslandThe Miriam HospitalRecruitingProvidence, Rhode Island, United States, 02903 Contact: Beth C Bock, PhD 401-793-8020 bbock@lifespan.org Principal Investigator: Beth C...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 22 ]
ALSWH Home Home
Updated:
(Dec 17, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...000 women in three cohorts who were aged 18-23, 45-50 and 70-75 when surveys began in 1996. In 2012/13 more than 17,000 young women aged 18-23 were recruited to form a...about the health of women across the lifespan, and informed federal and state government policies...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 23 ]
The Future of Nursing IOM Report - Campaign for Action | Campaign for Action
Updated:
(Sep 2, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...change to meet the needs of an aging, increasingly diverse population and to respond to a complex, evolving health care system. The recommendations in the report focus on the critical intersection between the health needs of patients across the lifespan and the readiness of the nursing workforce...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
The Emerging Doctor of Education (EdD) in Instructional Leadership for Nurse Educators.
(2013)
The Emerging Doctor of Education (EdD) in Instructional Leadership for Nurse Educators.
(2013)
[ 24 ]
European Policies and Initiatives | Healthy Ageing
Updated:
(Jul 6, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...text/html; charset=utf-8 European Policies and Initiatives | Healthy AgeingJump to navigation Search Healthy Ageing HomeSteps to Healthy AgeingHealthy Ageing Good PracticesEU Initiatives EIP/AHAPublications & LinksFollow UsYouTubeTwitterFacebookLinkedInApp iTunes - Gradient CheckApp Google - Gradient CheckEuroHealthNet WebsiteEuropean Policies...European Commission (EC) is taking proactive measures to tackle the future challenges posed by an ageing population by prioritizing initiatives that will contribute to building a healthy and active population for...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 25 ]
ciocd
Updated:
(May 4, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...for OCD and related disorders through the lifespan(pediatric, youth, and adult) representing 14 nations...we now know as OCD since the ... of 4 years old. We started seeing âspecialistsâ when he was about 5 years old. Many wrong diagnostics later, he was diagnosed with severe OCD at ... 12. He is now 14 years old...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 26 ]
CCMBL Database
Updated:
(Sep 18, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...LabAnnouncements Comparative Cellular and Molecular Biology of Longevity (CCMBL) DatabaseThe CCMBL database contains a wide range of cellular and molecular trait data from vertebrate species that has been collected by comparative biologists with the goal of identifying traits that are highly correlated with longevity. Currently the CCMBL database contains about a...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
A comparative cellular and molecular biology of longevity database.
(Oct, 2013)
A comparative cellular and molecular biology of longevity database.
(Oct, 2013)
[ 27 ]
ProteomeXchange Dataset
Updated:
(Jul 21, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...processes such as cellular metabolism, apoptosis, cellular senescence, cell cycle, and organism-level aging. Among the members of sirtuins showing different...and SIRT7: Implication of functional links to aging. Proteomics, 14(13-14):1610-22(2014...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 28 ]
Page Not Found | sgim.org
Updated:
(Jul 19, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Obesity Now the Leading Cause of Shorter Lifespan, Beats Diabetes and SmokingRead More Meet our...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Conducting high-value secondary dataset analysis: an introductory guide and resources.
(Aug, 2011)
Conducting high-value secondary dataset analysis: an introductory guide and resources.
(Aug, 2011)
[ 29 ]
Wheat protein database
Updated:
(Oct 24, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Mature Flag LeafObserved in Seedling RootObserved in Senescing LeafObserved in Mature RootsObserved in PericarpObserved in...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 30 ]
IDAC idac – site
Updated:
(Jan 9, 2003)
Rate Avg:
(
no ratings
)
(
no ratings
)
...site IDAC's Global AffiliationsIDAC's Global AffiliationsJapan's Center for Smart Aging ResearchIDAC: Japan's Center for Smart Aging ResearchRyuta KawashimaDirector, IDAC"LIVE TO RIDE and RIDE TO...CLOSEAbout UsGreeting & MissionNotable AlumniHistory of IDACResearch Facilities & FacultyResearch FacilitiesCommon FacilitiesResources & EquipmentBrain ImagingCell CenterEquipmentIDAC DATABASENEWS & EVENTSSmart Aging Research Center (S.A.R.C.)Admission & CoursesMaps & DirectionsGive to IDACContact UsMy IDACALUMNIJAPANESE CLOSEGreeting & MissionHealth and Longevity through SMART-AGING.IDAC is Japan's Center for Smart-Aging Research. We are a unique institute that is part of Tohoku University and we are affiliated with other national universities that also promote aging sciences. It is a well-known fact that Japanâs population is aging...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 31 ]
Cognitive Training Data
Updated:
(Oct 4, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Response LetterCognitive Training Data SignatoriesStanford Center on Longevity LetterStanford Center on Longevity Letter SignatoriesEvaluation CriteriaOur Self-evaluationPublished PapersAboutContactWhen it...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 32 ]
Genes & Development
Updated:
(Dec 27, 2002)
Rate Avg:
(
no ratings
)
(
no ratings
)
...deletion of enhancers during neurodevelopmentRegenerating muscle cells, senescence, and DNA damage responsesâRequest a...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
LIN-39/Hox triggers cell division and represses EFF-1/fusogen-dependent vulval cell fusion.
(Dec 15, 2002)
LIN-39/Hox triggers cell division and represses EFF-1/fusogen-dependent vulval cell fusion.
(Dec 15, 2002)
[ 33 ]
Academy on Violence and Abuse|AVA|ACE Study|Violence|Abuse|Education|Research|Resources
Updated:
(Sep 23, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Document Online Now A Link Across the Lifespan Animal Abuse as a Marker for Traumatic...effects of violence and abuse across the lifespan.The vision of the AVA is that the recognition, treatment, and prevention of the health effects of violence and abuse are fully integrated into healthcare and society so that people of all ages are safe and healthy. Affinity GroupsAVA Affinity...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Academy on violence and abuse: highlights of proceedings from the 2011 conference, "toward a new understanding".
(Oct, 2013)
Academy on violence and abuse: highlights of proceedings from the 2011 conference, "toward a new understanding".
(Oct, 2013)
[ 34 ]
Highest Quality Vitamins And Supplements - Life Extension
Updated:
(Sep 6, 2002)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Support Kidney & Bladder Support Liver Health & Detoxification Longevity & Wellness Men's Health Mood & Stress Management Sleep...how to reduce heart disease, slow the aging process, or prevent brain aging, Life Extension® reports it first.Subscribe TodayLearn...in your inbox weekly! Sign Up Anti-Aging News Newsletter ArchiveDaily NewsWhat's HotEventsBlog Media MultimediaPublic...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 35 ]
11
Updated:
(Aug 23, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...planning.Methods1. A survey of a national sample of 10% of the RNs of working ... (3,200 nurses). 2. Analysis of administrative data from the Ministry of Health' Nursing Division...characteristics and distribution by clinical field or economic sector, the percentage leaving work and the lifespan of full- or half-time work. This has hampered the assessment of the existing nursing...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 36 ]
A. aegypti (Aedes aegypti) Genome Browser Gateway
Updated:
(Sep 10, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...unprecedented high resolution map of the developmental lifespan of A. aegypti by sequencing 34 unique...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
The Developmental Transcriptome of the Mosquito Aedes aegypti, an Invasive Species and Major Arbovirus Vector.
(Sep 4, 2013)
The Developmental Transcriptome of the Mosquito Aedes aegypti, an Invasive Species and Major Arbovirus Vector.
(Sep 4, 2013)
[ 37 ]
Registro Brasileiro de Ensaios Clínicos
Updated:
(Oct 17, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...o procedimento.enIntervention study : assessment of the longevity of restorations and sealants placed using the...implementation, with the objective of verifying its longevity. Control intervention: assessing the longevity of restorations and sealants placed using the...implementation, with the objective of verifying its longevity. The results for both groups will be...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 38 ]
Small hive beetles survive in honeybee prisons by behavioural mimicry | SpringerLink
Updated:
(Sep 9, 2002)
Rate Avg:
(
no ratings
)
(
no ratings
)
...plant resins and continually guard them. The longevity of incarcerated beetles greatly exceeds their metabolic...Springer Nature © 2017 Springer International Publishing AG. Part of Springer Nature.Not logged in...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Small hive beetles survive in honeybee prisons by behavioural mimicry.
(Jul, 2002)
Small hive beetles survive in honeybee prisons by behavioural mimicry.
(Jul, 2002)
[ 39 ]
Grandparenting.org
Updated:
(Jun 18, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...it today! Welcome Greetings, grandparents of all ages. Breaking News:Problems between parents and grandparents seem to be on the increase. Let us know if you are seeing the same in your world.Have you noticed any change in the grandparent visitation laws in your state lately? If so, let us know.Seems that longevity is re-shaping grandparenthood. Many healthy...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 40 ]
Welcome to FOXODB
Updated:
(Jul 20, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Y.H. Li, G.G. Zhang, Towards understanding the lifespan extension by reduced insulin signaling: bioinformatics analysis...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 41 ]
e-BDporc
Updated:
(Jun 11, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Markov decision sow model representing the productive lifespan of herd sows. Agric. Sys. 76:253...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
GSEVM v.2: MCMC software to analyze genetically structured environmental variance models.
(Jun, 2010)
GSEVM v.2: MCMC software to analyze genetically structured environmental variance models.
(Jun, 2010)
[ 42 ]
WHO | World Health Organization
Updated:
(May 4, 2009)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Dental care and oral health for healthy longevity Word Congress 2015At the end of World Congress 2015, the Tokyo Declaration on Dental care and oral health for healthy longevity was adopted to call upon health policy...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Oral cancer prevention and control--the approach of the World Health Organization.
(Apr, 2009)
Oral cancer prevention and control--the approach of the World Health Organization.
(Apr, 2009)
[ 43 ]
Welcome to PvGEA Atlas
Updated:
(Oct 11, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...collected 1 to 4 days after floral senescence. Samples contain developing embryos at globular stagePH...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 44 ]
?doi=451053
Updated:
(Nov 15, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...com/?doi=451053.© 2016 S. Karger AG, BaselKeywordsAcute kidney injury · Renal replacement therapy...were predominantly (90%) male, with a mean ... of 60.2 (range 25-86). The...in the CVVHD-RCA mode). Circuit LifespanCircuit lifespan data are presented in figure 2. Overall...h. Fig. 2Survival curves for circuit lifespan. Reasons for Therapy InterruptionTherapy interruption was related...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 45 ]
Home - Enzo Life Sciences
Updated:
(Mar 27, 2003)
Rate Avg:
(
no ratings
)
(
no ratings
)
...the fight against cancer?A Peptide Targeting Senescent Cells Can Reverse AgingWhat are the differences...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Chemotherapy enhances TNF-related apoptosis-inducing ligand DISC assembly in HT29 human colon cancer cells.
(Mar 27, 2003)
Chemotherapy enhances TNF-related apoptosis-inducing ligand DISC assembly in HT29 human colon cancer cells.
(Mar 27, 2003)
[ 46 ]
Welcome to ielsg
Updated:
(Aug 21, 2007)
Rate Avg:
(
no ratings
)
(
no ratings
)
...leather breitling replica uk will probably have longevity. This cased characters should likewise be manufactured...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 47 ]
Network Search | Causal Bio Network
Updated:
(Apr 18, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...for DNA Damage, Autophagy, Cell Death, and Senescence. Bioinformatics and Biology Insights 7: 97-117...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 48 ]
Plant Expression Database
Updated:
(Feb 21, 2008)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Carbohydrate accumulation in barley leaves leads to senescence and protease g...BB52:Transcriptome analysis of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 49 ]
WebCite query result
Updated:
(Jun 29, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...than at any other stage in the lifespan. Despite the availability of effective treatments for...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 50 ]
20
Updated:
(May 5, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...life processes, from development through metabolism to senescence, aging and death (reviewed in [1]).While animals...for long-term functional assays, such as aging assays, where the miRNA in question needs...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Inhibiting miRNA in Caenorhabditis elegans using a potent and selective antisense reagent.
(Apr 1, 2010)
Inhibiting miRNA in Caenorhabditis elegans using a potent and selective antisense reagent.
(Apr 1, 2010)
[ 51 ]
Bat Genome Database: A database of Bat Genome
Updated:
(Jun 26, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Genome analysis reveals insights into physiology and longevity of the Brandt's bat Myotis brandtii. Nature...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 52 ]
Siggia ‘Lab’ Rockefeller Univ.
Updated:
(Oct 29, 2003)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Can anyone name a volume of comparable longevity for the practicing scientist?)Â My contemporaries...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Computational detection of genomic cis-regulatory modules applied to body patterning in the early Drosophila embryo.
(Oct 24, 2002)
Computational detection of genomic cis-regulatory modules applied to body patterning in the early Drosophila embryo.
(Oct 24, 2002)
[ 53 ]
The ubiquitination site
Updated:
(Feb 9, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...in plants. Besides regulation of the protein longevity via targeted degradation by the ubiquitin proteasome...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 54 ]
Single Port Laparoscopy - Fertility Sterility Discussion
Updated:
(Apr 30, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Effect? Journal Club Live July 2013Male Rejuvenation: Longevity Science or Dangerous Hype?- Journal Club LiveMay...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 55 ]
Chromosomal Transfer in Mature Oocytes - Fertility Sterility Discussion
Updated:
(Apr 30, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Effect? Journal Club Live July 2013Male Rejuvenation: Longevity Science or Dangerous Hype?- Journal Club LiveMay...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 56 ]
Anschutz Aurora & Denver Based Community Wellness Programs
Updated:
(Apr 11, 2005)
Rate Avg:
(
no ratings
)
(
no ratings
)
...disease progression, restore motor function, and increase longevity and quality of life.PWR! Circuit classes...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 57 ]
Standardization of laparoscopic pelvic examination - Fertility Sterility Discussion
Updated:
(Apr 1, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Effect? Journal Club Live July 2013Male Rejuvenation: Longevity Science or Dangerous Hype?- Journal Club LiveMay...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 58 ]
index
Updated:
(Sep 29, 2005)
Rate Avg:
(
no ratings
)
(
no ratings
)
...those with a giant nevus over the ... of 16. E-mail us for more...class?" For lots more information and practical, ...-appropriate techniques on handling stares, questions, and...medicine, length of time used, frequency, and ..., with babies/infants seeming to be at...AND HEALTH AND WELL-BEING OVER THE LIFESPAN Contrary to popular myth, children are NOT...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Congenital melanocytic nevus and the Internet: an evaluation of available web-based resources.
(Sep, 2005)
Congenital melanocytic nevus and the Internet: an evaluation of available web-based resources.
(Sep, 2005)
[ 59 ]
m:Explorer -- multinomial regression models of transcriptional regulation
Updated:
(Sep 14, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...models reveal positive and negative regulators of longevity in yeast quiescence (2012) Genome Biol 13...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 60 ]
17482968.2011.590992
Updated:
(Oct 10, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...post-mitotically, given that ALS is an ...-related disease.Meeting report of the International...in SOD1-G93A rat modelâ Short lifespan of SOD1-G93A rats versus long maturation...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 61 ]
Welcome to Toxipedia - Toxipedia
Updated:
(Jan 22, 2009)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Forward#19: Linus Pauling, Scientist for the Ages"It is sometimes said that science has...multiple environments influence our health across the lifespan.The stories are accessible to an educated...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Historical milestones and discoveries that shaped the toxicology sciences.
(2009)
Historical milestones and discoveries that shaped the toxicology sciences.
(2009)
[ 62 ]
s13059-015-0714-1
Updated:
(Jul 11, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...C. elegans and mammalian systems. The short lifespan of C. elegans allows the survival of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 63 ]
OrthoMaM project
Updated:
(Jun 26, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...61. A new method for estimating species ... supports the coexistence of malaria parasites and...-971, 2012.28. A method to find longevity-selected positions in the mammalian proteome. J....2010.09. An evolutionary genome scan for longevity-related natural selection in mammals. R. W....
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
OrthoMaM: a database of orthologous genomic markers for placental mammal phylogenetics.
(2007)
OrthoMaM: a database of orthologous genomic markers for placental mammal phylogenetics.
(2007)
[ 64 ]
Duplicate regions on chromosomes 4 and 8
Updated:
(Jan 24, 2008)
Rate Avg:
(
no ratings
)
(
no ratings
)
...39. Tb927.4.4740/Tb927.8.7730 longevity-assurance protein 40. Tb927.4.4730/Tb927...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Evolutionary consequences of a large duplication event in Trypanosoma brucei: chromosomes 4 and 8 are partial duplicons.
(Nov 23, 2007)
Evolutionary consequences of a large duplication event in Trypanosoma brucei: chromosomes 4 and 8 are partial duplicons.
(Nov 23, 2007)
[ 65 ]
abstract
Updated:
(May 28, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Paolo Spallarossa, 5-fluorouracil causes endothelial cell senescence: potential protective role of glucagon-like peptide...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 66 ]
tisei.org
Updated:
(Apr 24, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...compaction. Compaction is the key to the longevity of your new driveway. www.dumpsterrentalpassaicnj.comwww...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 67 ]
Pro Hair Loss Insight & Modern Education - Phime.org
Updated:
(Feb 14, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...growth for each follicle. In theory, the longevity of the hair staying in the anagen...of men will experience MPB by the ... of 30, and 2/3 begin balding by the ... of 60. Research also indicates that men...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 68 ]
bird-tracking-gull-occurrences
Updated:
(Feb 15, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...mass), life history data (day of ringing, ..., resightings by volunteers), as well as growth...GPS tracker no longer functions (typical tracker lifespan: 2-3 years). Bibliographic Citations Stienen EWM...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 69 ]
17
Updated:
(Aug 23, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...estimated as were additional costs due to increased longevity of program participants. Data on costs and QALYs...A program directed at the entire Israeli population aged 20 and over, using a variety of eight...BMI levels.The BMI prevalence distribution for adults aged 20 and above [Personal Communication, Dr Tami Shohat, Israel Centre for Disease Control] was multiplied by the total adult population aged 20 and above in 2010 of 4,835...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 70 ]
1471-2105-8-410-S1
Updated:
(Feb 13, 2008)
Rate Avg:
(
no ratings
)
(
no ratings
)
...A-3mer3[-40,-20] www.spliceport.org Found 346 features in this interval -------------ctgacc--||AG 0.179837 ------------ctgacc---||AG 0.167811 -----------ctgacc----||AG 0.145336 --------------cctgac-||AG 0.141731 ---------ctgacc------||AG 0.136983 -------ctgacc--------||AG 0.135907 ---------------ctgacc||AG 0.135844 --------------ctcacc-||AG 0.125415 ------------ctcacc---||AG 0.121931 ------------cctgac---||AG 0.120181 ---------ccctga------||AG 0.118673 --------------taactg-||AG 0.118501 --------------tctgac-||AG 0.118146 ------------taactt---||AG 0.115586 -----------gctgac----||AG 0.113899 --------ctgact-------||AG 0.112664 -------------cctgac...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 71 ]
1207
Updated:
(Mar 21, 2001)
Rate Avg:
(
no ratings
)
(
no ratings
)
...the mdx/utrâ/â mice extended their longevity by threefold, reduced kyphosis and the development of muscle...and die prematurely between 4 and 20 wk of ... (Deconinck et al. 1997b; Grady et al. 1997b).To...of the α7BX2 chain isoform show greatly improved longevity and mobility compared with nontransgenic mdx/utrâ/â...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Enhanced expression of the alpha 7 beta 1 integrin reduces muscular dystrophy and restores viability in dystrophic mice.
(Mar 19, 2001)
Enhanced expression of the alpha 7 beta 1 integrin reduces muscular dystrophy and restores viability in dystrophic mice.
(Mar 19, 2001)
[ 72 ]
Helmholtz Allianz Preclinical Comprehensive Cancer Center - PCCC
Updated:
(Sep 3, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...and CancerGenetic EpidemiologyStaffSoftwareMolecular Genetic EpidemiologyStaffProjectsPublicationsToolsEUNAMClinical Epidemiology and Aging ResearchProjectsStaffPublicationsAnnouncementsOpeningsBiostatisticsStaffBiostatistical Service and Support Statistics CoursesResearchPredictive modelingClinical...MortalityComparison with Other Causes of DeathTrendsOverviewOverview by ... rangeInternational ComparisonSurvival RatesCancer IncidenceLeading Causes of Cancer...and CancerGenetic EpidemiologyStaffSoftwareMolecular Genetic EpidemiologyStaffProjectsPublicationsToolsEUNAMClinical Epidemiology and Aging ResearchProjectsStaffPublicationsAnnouncementsOpeningsBiostatisticsStaffBiostatistical Service and Support Statistics CoursesResearchPredictive modelingClinical...MortalityComparison with Other Causes of DeathTrendsOverviewOverview by ... rangeInternational ComparisonSurvival RatesCancer IncidenceLeading Causes of Cancer...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 73 ]
Blood lipids influence DNA methylation in circulating cells | Genome Biology | Full Text
Updated:
(Jul 15, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...and women (32â60 % men) and the ... of the individuals ranged from 18 to 81...Diabetes and Atherosclerosis Maastricht, LL LifeLines, LLS Leiden Longevity Study, NTR Netherlands Twin Register, PAN Prospective ALS...Atherosclerosis Maastricht (CODAM) [33], LifeLines (LL) [34], Leiden Longevity Study (LLS) [35], the Netherlands Twin Register (NTR...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 74 ]
Membrane domain organization of myelinated axons requires βII spectrin | JCB
Updated:
(Nov 12, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...controls. However, starting at two weeks of ..., cKO mice exhibited significant hind leg clasping...strength at 2 and 4 mo of .... Avil-Cre;SPNB2f/f mice have significantly...muscle strength, we observed that at all ages the cKO mice had significantly reduced grip...3 A, arrow). By two weeks of ... in control mice, fewer than 20% of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 75 ]
Discs of mammalian rod photoreceptors form through the membrane evagination mechanism | JCB
Updated:
(Nov 10, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...continuous renewal throughout the animalâs lifespan, with new membranes added at the outer...Expression of human complement factor H prevents ...-related macular degeneration-like retina damage and kidney abnormalities in aged Cfh knockout mice. Am. J. Pathol. 185...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 76 ]
UCL Institute of Health Equity - IHE
Updated:
(Apr 14, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...12 years before someone of the same ... in Swansea west Call for change to...Panorama, discussing AmazonHealth Study Highlights Minority InequalitiesShorter lifespans among poor costing Europe trillionsCNN Opinion Piece...ready to start school'Half of English pupils aged five 'are not ready for school when...resilienceSocial Determinants of Health and the Working-... Population: Global Challenges and Priorities for ActionUK...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 77 ]
s12916-016-0621-7
Updated:
(Jun 18, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...gametocytaemia by microscopy at enrolment was 12.1 % (5887/48,589), and increased with decreasing ..., decreasing asexual parasite density and decreasing haemoglobin concentration, and was higher in patients without fever...treatment, gametocytes may persist for several weeks after the clearance of asexual parasites with their longevity and infectivity depending on the treatment dispensed [8, 9], dosing [10] and host immunity [5...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 78 ]
jcb.201211160
Updated:
(May 14, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...adaptation to stress, starvation, and protection from aging, cancer, neurodegeneration, and invading pathogens (Mizushima et...Syx17 mutant brains (B) compared with similarly aged controls (A). (CâE) No autophagosomes...Syx17 in mutant brains, unlike in similarly aged controls (Fig. S2, DâF). TUNEL...autophagy promotes neuronal health, stress tolerance, and longevity but is dispensable for metamorphosis in Drosophila...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 79 ]
Disease Discovery
Updated:
(Aug 22, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...intraarticular calcificationCafe-au-lait spotBuphthalmosBulimia/hyperphagiaBuild/stature/longevity anomaliesBrushfield spotsBruisabilityBronchogenic cystBronchiolitisBronchial dilation/dilatation/bronchiectasiaBroad/bifid...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 80 ]
Cancer Proteomics Database
Updated:
(Feb 7, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...DNA damage, mitotic stress, genomic instability, apoptosis, senescence, growth signalling, angiogenesis, inflammation and infection play...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
ApoptoProteomics, an Integrated Database for Analysis of Proteomics Data Obtained from Apoptotic Cells.
(Feb, 2012)
ApoptoProteomics, an Integrated Database for Analysis of Proteomics Data Obtained from Apoptotic Cells.
(Feb, 2012)
[ 81 ]
Cancer Proteomics Database
Updated:
(Jan 15, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...DNA damage, mitotic stress, genomic instability, apoptosis, senescence, growth signalling, angiogenesis, inflammation and infection play...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 82 ]
Cancer Proteomics Database
Updated:
(May 3, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...DNA damage, mitotic stress, genomic instability, apoptosis, senescence, growth signalling, angiogenesis, inflammation and infection play...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Cell death proteomics database: consolidating proteomics data on cell death.
(May 3, 2013)
Cell death proteomics database: consolidating proteomics data on cell death.
(May 3, 2013)
[ 83 ]
RNASeqMetaDB
Updated:
(Dec 15, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...their activationFoxp3Noneregulatory T-lymphocyteE-GEOD-57396An aging-like phenotype occurs in Tif1γ-/- hematopoietic stem...alpha Het) to elucidate the effect of senescence in mouse colorectal tumorCsnk1a1, Trp53, Cdkn1aColorectal NeoplasmsenterocyteE...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 84 ]
International Society for the Study of the Aging Male(ISSAM)
Updated:
(Nov 21, 2003)
Rate Avg:
(
no ratings
)
(
no ratings
)
...charset=us-ascii International Society for the Study of the Aging Male(ISSAM)About ISSAMExecutive CouncilObjectivesRationalStrategic IntentMembershipApplication for 2017 membershipRenewal for 2017 membershipUpdate form Sponsor & Affiliation CriteriaCo-Sponsor CriteraAffiliation CriteraEndorsement CriteraTools & ServicesFree & Bioavailable Testosterone calculatorThe aging males' symptoms (AMS) rating scaleLate-onset HypogonadismAlliance for Aging ResearchSelected ISSAM presentations at 5th World Congress of the Aging MaleSelected ISSAM presentations at 4th World Congress of the Aging...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 85 ]
Welcome to the Digital Ageing Atlas, the portal of ageing related changes | The Digital Ageing Atlas
Updated:
(Jan 16, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
25232097 http://ageing-map.org/ text/html; charset=us-ascii Welcome to the Digital Ageing Atlas, the portal of ageing related changes | The Digital Ageing AtlasThe Digital Ageing AtlasNavigationAboutHelpDownloadsContact or contributeSearch Human MouseSearchUse anatomical modelWelcome to the Digital Ageing Atlas, the portal of ageing-related changesThe Digital Ageing Atlas (DAA) is a portal of age-related...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 86 ]
jcb.201506065
Updated:
(Jan 5, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Cbx4 protein protects epithelial stem cells from senescence through PRC-dependent repression of the Ink4a...At E16.5, the appearance of the senescence-associated marker γ-H2AX was seen in...expression of the cell cycle inhibitor genes (senescence-linked Ink4a locus p16/p19 and Cdkn1c...ns, not significant.Given that Cbx4 suppresses senescence in human epidermal KCs (Luis et al., 2011), we examined the mechanisms underlying the Cbx4-dependent regulation of the senescence-linked cell cycle inhibitor genes and performed...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 87 ]
Home || Aging Life Care Association
Updated:
(Aug 26, 2003)
Rate Avg:
(
no ratings
)
(
no ratings
)
12938251 http://www.aginglifecare.org/ text/html; charset=utf-8 Home || Aging Life Care Association Skip to main content Loading ALCA LOGOFind an Aging Life Care CoachToggle navigation HomeAbout UsEventsContactMember ResourcesSign InALCA LOGOFormerly National Association of Professional Geriatric Care ManagersFacebookTwitterLinkedInYoutubeKeyword SearchFind an Aging Life Care CoachAbout Aging Life CareToggleWhat you need to knowSelecting an Aging Life Care ProfessionalWorking with an Aging Life Care ProfessionalCertification and Professional ConductALCA BlogALCA Consumer LibraryVideo LibraryConsumer ResourcesFind an Aging Life Care...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Dementia patients in primary care. Care managers offer a solution to providing ongoing care.
(Aug, 2003)
Dementia patients in primary care. Care managers offer a solution to providing ongoing care.
(Aug, 2003)
[ 88 ]
WHO | Proposed working definition of an older person in Africa for the MDS Project
Updated:
(Jul 16, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...developed in 2002 to define the scope of the Project on Minimum Data Set for Ageing in Africa. For further information on ageing and WHOâs current strategy on Ageing and Health, please visit the WHO web pages on ageing and life-course.Most developed world countries have accepted the chronological ... of 65 years as a definition of 'elderly' or older person, but like many westernized...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 89 ]
Flinders Centre for Ageing Studies
Updated:
(Dec 3, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...html; charset=us-ascii Flinders Centre for Ageing StudiesStudyResearchEngageAlumniAboutQuick links Current students Staff Library Student Two - Staff Flinders dashboard (Okta) Flinders Learning Online (FLO) Campus map: Bedford Park Staff directory Jobs at Flinderspowered bySection navigationFlinders Centre for Ageing StudiesHomeHistoryALSAStaff & AffiliatesResearch Projects and ActivitiesCommunity presentationsAgeing Seminar...Behavioural Sciences > Flinders Centre for Ageing Studies Flinders Centre for Ageing Studies The Flinders Centre for Ageing Studies (FCAS) has a multidisciplinary focus on...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 90 ]
The Survey of Health, Ageing and Retirement in Europe (SHARE): Home
Updated:
(Aug 22, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...charset=utf-8 The Survey of Health, Ageing and Retirement in Europe (SHARE): Home______________ SHARE - Survey of Health, Ageing and Retirement in Europe - Survey of Health, Ageing and Retirement in Europe HomeOrganisation›Dates & FactsSHARE...are here: HomeSHARE - Survey of Health, Ageing and Retirement in EuropeThe Survey of Health, Ageing and Retirement in Europe (SHARE) is a...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
The frailty index in Europeans: association with age and mortality.
(Sep, 2012)
The frailty index in Europeans: association with age and mortality.
(Sep, 2012)
[ 91 ]
s12915-016-0296-8
Updated:
(Sep 20, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...type strains are shown. c Study of longevity of the sexing strains at standard and cooler temperatures. Longevity at 25 °C (dark curves) and 19 °C (light curves) of males from the J06 parental strain, the FL12-56 and FL11-15 transgenic lines. Two replicates of longevity tests with 50 males were combined and...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 92 ]
AG-Epilepsiechirurgie: Übersicht
Updated:
(Jun 24, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
24861193 http://www.ag-epilepsiechirurgie.de/ text/html; charset=unknown-8bit AG-Epilepsiechirurgie: ÜbersichtAG-EpilepsiechirurgieArbeitsgemeinschaft für prächirurgische Diagnostik und...Sie befinden sich auf der Seite der AG - EpilepsiechirurgieSponsored by:Ausserordentliche Mitglieder (Fördermitglieder):Andere Förderungen:Förderung der Minifellowships der AG, 1. Kohorte durch:UCB Pharma GmbH DeutschlandAktuellesEs sind jetzt die AG-Epilepsiechirurgie Anstecker verfügbar! Näheres unter AktuellesCopyright © 2017 AG-EpilepsiechirurgieDesign by Marcus Belke | Powered by TYPO3...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 93 ]
Home | ShARM
Updated:
(Dec 3, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...resources to accelerate research into ageingMain menuGet Aged MiceProvide Aged MiceWelfareJoin the ShARM CommunityFAQAbout UsContact UsShARM is a not for profit organisation, open to all scientific investigators in the UK and overseas, aiming to accelerate research into ageing by facilitating the sharing of resources. ShARM provides immediate and cost effective access to aged murine models and their tissues, and promotes...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Shared Ageing Research Models (ShARM): a new facility to support ageing research.
(Dec, 2013)
Shared Ageing Research Models (ShARM): a new facility to support ageing research.
(Dec, 2013)
[ 94 ]
s12915-016-0319-5
Updated:
(Nov 19, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...cytoplasmic incompatibility) who have passed the minimum ... for the first oviposition (T G ; Additional...supporting dataData from field-cage experiments: mosquito ...-class abundances and Wolbachia infection frequencies, and...Moyes CL, Drake JM, Brownstein JS, Hoen AG, Sankoh O, et al. The global distribution...ArticlePubMedPubMed CentralGoogle ScholarHancock PA, White VL, Callahan AG, Godfray HCJ, Hoffmann AA, Ritchie SA. Density...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 95 ]
AGE download page
Updated:
(Feb 22, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
21233167 http://sv.gersteinlab.org/.../ text/html; charset=us-ascii ... download page By downloading ... software you agree to the terms of Creative Commons license (Attribution-NonCommerical). Download: ... v0.4; September 12, 2011 Added functionality to align sequences with inversions or tandem duplications. Improved search for alternative alignments.... v0.2AGE v0.1...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 96 ]
FARA - Research Pipeline
Updated:
(Aug 28, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...-743 treated subjects when compared to an ..., sex and disease-severity matched natural history...ataxia. MOXIe is enrolling individuals with FA ages 16-40 years who are able to...study is now enrolling individuals with FA ages 10-50 years: link to post on...mitochondrial function and some studies suggest increased longevity, lowering glucose levels and anti-cancer activity...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 97 ]
jcb.201507042
Updated:
(Feb 2, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...2008. ATR signaling can drive cells into senescence in the absence of DNA breaks. Genes...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 98 ]
ProteinHistorian: Protein Age Estimation and Enrichment Analysis
Updated:
(Jul 4, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...ProteinHistorian/ text/html; charset=us-ascii ProteinHistorian: Protein ... Estimation and Enrichment AnalysisProteinHistorian: Protein ... Estimation and Enrichment AnalysisProteinHistorian identifies enrichment for proteins of different phylogenetic ages in protein sets of interest. ProteinHistorian is to...can be uploaded to combine with the protein ... analysis. ProteinHistorian is described in the following paper: Capra JA, Williams AG, and Pollard KS. ProteinHistorian: Tools for the Comparative...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
ProteinHistorian: Tools for the Comparative Analysis of Eukaryote Protein Origin.
(2012)
ProteinHistorian: Tools for the Comparative Analysis of Eukaryote Protein Origin.
(2012)
[ 99 ]
000356048
Updated:
(Feb 14, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...10.1159/000356048).© 2013 S. Karger AG, BaselKeywordsAnimal model · Ischemic stroke · 3...Bipolar coagulator (AESCULAP tb50; B. Braun Melsungen AG, Melsungen, Germany) ⢠Micorforceps connected to the coagulator (GK690R, B. Braun Melsungen AG)⢠Bone rongeur for zygomatic...Microsurgery scissors (AESCULSP FD012R, B. Braun Melsungen AG) ⢠Needle and a thread...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 100 ]
1471-2105-8-410-S2
Updated:
(Feb 13, 2008)
Rate Avg:
(
no ratings
)
(
no ratings
)
...in the set A-3mer1[-60,-5] at the end of the file. -----------------------ctga---------------------AG, 24, 0.178431 ---------------------------ctga-----------------AG, 20, 0.161183 --------------------------ctga------------------AG, 21, 0.161072 ------------------------ctga--------------------AG, 23, 0.153586 ----------------------ctga----------------------AG, 25, 0.142684 ---------------------ctga-----------------------AG, 26, 0.132723 --------------------ctga------------------------AG, 27, 0.126387 ----------------------------ctga----------------AG, 19, 0.119018 ------------------ctga--------------------------AG, 29, 0.0883748 -----------------ctga---------------------------AG, 30, 0.0610774 -----------------------ctaa---------------------AG, 24, 0.157934 --------------------ctaa------------------------AG, 27, 0.151807 ------------------------ctaa--------------------AG...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 101 ]
Landon Center on Aging
Updated:
(Mar 9, 2001)
Rate Avg:
(
no ratings
)
(
no ratings
)
...http://www.kumc.edu/landon-center-on-aging.html text/html; charset=utf-8 Landon...Kansas HospitalLandon Center on AgingLandon Center on Aging SearchCenter HomeGeriatricsGeriatricsEducationClinicalDoctor PresentationsResearchTeachingCommunity Outreach ProgramsCommunity Outreach ProgramsBrownbag Lunch SeriesFamily Caregiver's Support GroupForever Young ChoirImages of Aging Photo ContestLandon Fitness CenterSpecial EventsResearchResearchHuman Performance LaboratoryGrayhawk...many other Midwestern states, has a growing aging population, with 493,000 persons over the ... of 65 expected in 2020 and 42,000 over the ... 85. As Baby Boomers continue to come...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Stroke care: a method for measuring compliance with AHCPR guidelines.
(Mar, 2001)
Stroke care: a method for measuring compliance with AHCPR guidelines.
(Mar, 2001)
[ 102 ]
WHO | WHO Study on global AGEing and adult health (SAGE)
Updated:
(Jan 3, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...utf-8 WHO | WHO Study on global AGEing and adult health (SAGE)Skip to main...universal health coveragePublications WHO Study on global AGEing and adult health (SAGE) WHO's SAGE is a longitudinal study collecting data on adults aged 50 years and older, plus a smaller comparison sample of adults aged 18â49 years, from nationally representative...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Data resource profile: the World Health Organization Study on global AGEing and adult health (SAGE).
(Dec, 2012)
Data resource profile: the World Health Organization Study on global AGEing and adult health (SAGE).
(Dec, 2012)
[ 103 ]
Nuclear envelope rupture is induced by actin-based nucleus confinement | JCB
Updated:
(Oct 4, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...8 s), our data suggest that the longevity of chromatin herniations correlates with the frequency...and R01NS096786), the Glenn Family Foundation for Aging Research, the NOMIS Stiftung, the American Cancer...Wilson. 2005. The nuclear lamina comes of .... Nat. Rev. Mol. Cell Biol. 6:21â...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 104 ]
NAES - Nevada Agricultural Experiment Station, University of Nevada, Reno
Updated:
(Jan 26, 2005)
Rate Avg:
(
no ratings
)
(
no ratings
)
15669290 http://www.ag.unr.edu/ text/html; charset=us-ascii...AreasList of ProjectsImpacts of ResearchResearch FundingFacilitiesPeoplePublicationsNewsCalendarResourcesCollege of Ag (CABNR)Subscribe to NewsletterVisit The CampusCooperative ExtensionContact UsNevada Ag Experiment Station Mail Stop 221 1664 N. Virginia Street Reno, NV 89557 Phone (775) 784-6237 Fax (775) 784-4227 Max Fleischmann Ag Bldg, Room 201Location/Directions Feral...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[World trends of systems biology related to the genome network project]
(Dec, 2004)
[World trends of systems biology related to the genome network project]
(Dec, 2004)
[ 105 ]
ProteomeXchange Dataset
Updated:
(Apr 24, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...dataRepositorySupport: Unsupported dataset by repositoryPrimarySubmitter: Kelly StauchTitle: Aging Mouse Brain Mitochondria LC-MS/MSDescription: This study investigates the proteomic alterations in brain mitochondria isolated from 5- (mature), 12- (old), and 24-month-old (aged) mice to examine normal "healthy" aging. Using quantitative mass-spectrometry based super-SILAC...potentially allow for compensatory mechanisms to combat aging.SpeciesList: scientific name: Mus musculus (Mouse); NCBI...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 106 ]
AG Mednet — Improving Data Quality in Global Clinical Trials
Updated:
(Sep 20, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...agmednet.com/ text/html; charset=utf-8 AG Mednet â Improving Data Quality in...organizations and principal investigators. Read More...SupportThe AG Mednet Global Help Desk is available 24x7x365 to support users around the globe. Our call center fields the call, initiates the troubleshooting, and assigns an AG Mednet technical resource. Read More...Download our...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 107 ]
Home - Cell Symposia Aging and Metabolism
Updated:
(Jun 16, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
27304491 http://www.cell-symposia-aging-metabolism.com/ text/html; charset=utf-8 Home - Cell Symposia Aging and Metabolism Cell Symposia Home Cell...out the conference app here » The word "aging" encompasses a range of physiological changes in...processes that ultimately decline or shift during aging. The recent wealth of information on how perturbation of metabolic factors can accelerate or impair aging processes makes this an exciting time to...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 108 ]
jcb.201601014
Updated:
(Aug 16, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...important for maintaining synapse integrity over the lifespan. We tested for differential expression of Drosophila...M. Hammarlund. 2014. Insulin/IGF1 signaling inhibits ...-dependent axon regeneration. Neuron. 81:561â...KIF1A is a key regulator of synaptic aging and insulin signaling-regulated memory. Curr. Biol...02.017OpenUrlCrossRefPubMedâµOâNeill, L.A.J., and A.G. Bowie. 2007. The family of five: TIR...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 109 ]
46
Updated:
(Jun 14, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...into the fermentable glucose is hampered. The senesced inflorescence stems of a set of 20...lignin, cellulose, and matrix polysaccharides) of the senesced inflorescence stems of Arabidopsis mutants, mutated in...the final height and weight of the senesced inflorescence stems of the mutants with those...measured by the weight of the primary senesced inflorescence stem (without rosette leaves, axillary inflorescences...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 110 ]
Gen Silent — The LGBT Aging Film
Updated:
(May 24, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...-8 Gen Silent â The LGBT Aging FilmGen SilentThe LGBT Aging FilmAboutAboutThe FilmmakersAcclaim for the FilmThe PeoplePast ScreeningsFAQsLGBT Aging ResourcesPurchasePurchaseTerms of UseTools for your screeningPress KitContactContact...most real film I have seen about aging -- period. Gen Silent reminds us of our...of people are fighting to keep LGBT aging from meaning aging in silence.Read MoreAbout the FilmmakerStu is...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 111 ]
WebCite query result
Updated:
(Jun 9, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...charset=us-ascii Physical Activity, Sleep and ... - Full Text View - ClinicalTrials.govSkip to Main...smallerResetcloseHomeFind StudiesStudy Record DetailPhysical Activity, Sleep and ... This study has been completed. Sponsor: Maastricht...to assess relations between these indexes and ...;Intervention study to assess the effect of exercise training on daily life movement efficiency and quality of sleep in ageing subjects45 healthy human volunteers, ... 50-83 yr, BMI 20-30 kg...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 112 ]
ISRCTN30189842
Updated:
(Mar 28, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Intervention Infants will be enrolled at term equivalent ... and will be prospectively followed-up from term to 12 months of corrected ....At term equivalent ... infants will be randomised in four groups:Group 1: infants born average for gestational ... (AGA) fed nutrient-enriched post-discharge formula (2....
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 113 ]
A matrix metalloproteinase mediates long-distance attenuation of stem cell proliferation | JCB
Updated:
(Sep 30, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...ratios to the progeny classes; however, the lifespan, fertility, and follicle cell phenotypes of adult...were collected every 2 d upon eclosion, aged at 29°C for 5 d, exposed...d upon eclosion to 29°C, and aged 7â10 d before dissection. For...scored. Stem cell clones were identified by aging the flies for 7 d after clone...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 114 ]
QUT | Working with Older People | Home
Updated:
(Jul 14, 2008)
Rate Avg:
(
no ratings
)
(
no ratings
)
...will show you many interesting aspects of ageing and introduce you to some of the...keeps him fit and active at the ... of 84. He has fair skin and little head hair. What could you be investigating to assess Jack's health status?Read more about The Orchid Man storyWhat’s covered in the modulesActive Ageing & Health Promotion Older Persons in the Acute...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 115 ]
404 Error - Nevada Agricultural Experiment Station, University of Nevada, Reno
Updated:
(Sep 5, 2001)
Rate Avg:
(
no ratings
)
(
no ratings
)
...AreasList of ProjectsImpacts of ResearchResearch FundingFacilitiesPeoplePublicationsNewsCalendarResourcesCollege of Ag (CABNR)Subscribe to NewsletterVisit The CampusCooperative ExtensionContact UsNevada Ag Experiment Station Mail Stop 221 1664 N. Virginia Street Reno, NV 89557 Phone (775) 784-6237 Fax (775) 784-4227 Max Fleischmann Ag Bldg, Room 201Location/Directions Page Not...-6237 Fax (775) 784-4227 Max Fleischmann Ag, Room 201Location/DirectionsNevada Agricultural Experiment Station Mail...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 116 ]
www.kamick.org
Updated:
(Apr 3, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Models for predicting the adult height and ... at first menstruation of girls with idiopathic central precocious pubertyModels for predicting the adult height and ... at first menstruation of girls with idiopathic central precocious pubertyThe formula below is based on the work:Models for predicting the adult height and ... at first menstruation of girls with idiopathic...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 117 ]
AJP-Heart and Circulatory Podcasts » Aging Impairs Endothelial Ca2+ Signaling
Updated:
(May 20, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
26945073 http://ajpheart.podbean.com/e/aging-impairs-endothelial-ca2-signaling/ text/html; charset=utf-8 AJP-Heart and Circulatory Podcasts » Aging Impairs Endothelial Ca2+ SignalingAJP-Heart and Circulatory...2016 — khkeehan We know that as we ..., blood vessels become less effective at getting...smooth muscle cells of microvessels contribute to aging-related vascular dysfunction? Listen as Guest Editor...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 118 ]
EXAMINER | UCSF Memory and Aging Center
Updated:
(Jun 11, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...charset=utf-8 EXAMINER | UCSF Memory and Aging CenterUCSFUniversity of California, San FranciscoAbout UCSFUCSF Medical CenterUCSF Memory and Aging CenterEspanolChineseUCSF Memory and Aging CenterEducationPatient CareCaregiving & SupportResearch & Clinical TrialsOur CenterResource SharingDonate to the UCSF Memory and Aging CenterSearch this site: BlogYouTubeTwitterFacebookGet EmailEXAMINERCohortsBiospecimensBrain BankDataTechnologyVideoEXAMINERBackgroundExecutive functioning...is adaptable across a wide range of ages and disorders.Read MoreProject StructureEXAMINER was developed...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Dissociable executive functions in behavioral variant frontotemporal and Alzheimer dementias.
(Jun 11, 2013)
Dissociable executive functions in behavioral variant frontotemporal and Alzheimer dementias.
(Jun 11, 2013)
[ 119 ]
PML isoform II plays a critical role in nuclear lipid droplet formation | JCB
Updated:
(Jan 5, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...been ascribed, including transcriptional regulation and cellular senescence. The PML NB core is made of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 120 ]
MetaSV
Updated:
(Aug 8, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...SV breakpoints using assembled contigs. Please compile ... without OpenMP support using make OMP=no...bam alignments.bam --spades SPAdes/spades.py --age AGE/age_align --num_threads 15 --workdir work --outdir...bam alignments.bam --spades SPAdes/spades.py --age AGE/age_align --num_threads 15 --workdir work --outdir...bam alignments.bam --spades SPAdes/spades.py --age AGE/age_align --num_threads 15 --workdir work --outdir...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 121 ]
H1237.long
Updated:
(Dec 2, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...no obvious pathology at 9 mo of ..., indicating full regeneration. Utilizing the same assays...siRNA-mediated knockdown in rat neonatal cardiomyocytes (... is unclear) increased rates of histone H3...suggested that cardiomyocyte proliferation markedly decreased with .... Considering that the use of αMHC...efficiency of mammalian cardiomyocytes decreases dramatically with ..., which might be at least in part...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 122 ]
Working Longer Group - NHS Employers
Updated:
(Nov 27, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...workforce working to a later, raised retirement .... It was a partnership group of national...implications of working to a raised retirement .... We have also produced a range of tools and resources to assist employers and employees. Our tools and resources include:The ... awareness toolkit â helping organisations assess and action plan their readiness for the opportunities and challenges of an ageing workforce.Improving your understanding of the NHS...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 123 ]
WebCite query result
Updated:
(Dec 20, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...an online access panel 2. In the ages between 15 and 20 years, either sex...moderate drinking. The advice for young adults aged 18 - 20 years is in line with the guidelines of the Dutch National Health Council recommending that men should not drink more than 2 glasses alcohol per day and women 1 glass alcohol per day (Dutch National Health Council, 2009). Adolescents under the ... of 16 receive advice to abstain from...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 124 ]
Home | AgEBB
Updated:
(Nov 21, 2002)
Rate Avg:
(
no ratings
)
(
no ratings
)
...NetworkUniversity of Missouri Extension Regional NewslettersNorthest Region Ag ConnectionSoutheast Region and East Central Missouri Ag NewsNorthwest Region News You Can UseSouthwest Region Southwest Missouri NewsWest Central Region Ag in FocusCrop and Plant ResourcesCottonHorticultureIntegrated Pest ManagementMissouri...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 125 ]
RRE-90
Updated:
(Jan 12, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...different circulations Yes NoMultiple infarcts of different ages Yes NoIsolated cortical infarcts Yes NoCCS etiologic...Schwamm LH, Furie KL, Koroshetz WJ, Sorensen AG. A score to predict early risk of recurrence after ischemic stroke. Neurology. 2010 Jan 12;74(2):128-35 (PubMed abstract).Ay H, Benner T, Arsava EM, Furie KL, Singhal AB, Jensen MB, Ayata C, Towfighi A, Smith EE, Chong JY, Koroshetz WJ, Sorensen AG. A Computerized Algorithm for Etiologic Classification of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
A score to predict early risk of recurrence after ischemic stroke.
(Jan 12, 2010)
A score to predict early risk of recurrence after ischemic stroke.
(Jan 12, 2010)
[ 126 ]
Molecular Diversity Preservation International (MDPI)
Updated:
(Sep 24, 2004)
Rate Avg:
(
no ratings
)
(
no ratings
)
...at www.mdpi.com. May 2010: MDPI AG was founded where MDPI stands for Multidisciplinary...net. This was taken over by MDPI AG. © 1996-2013 Molecular Diversity Preservation International (MDPI), Basel, Switzerland (http://www.mdpi.org) Since 2013, maintained by MDPI AG (http://www.mdpi.com) Last change: 26...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 127 ]
WHO | WHO Anthro (version 3.2.2, January 2011) and macros
Updated:
(Jun 2, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...the attained growth standards (length/height-for-..., weight-for-..., weight-for-length, weight-for-height, body mass index-for-..., head circumference-for-..., arm circumference-for-..., triceps skinfold-for-... and subscapular skinfold-for-...). Download Rzip, 506kbRead mepdf, 200kbDownload SPSSzip, 554kbRead...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Growth of exclusively breastfed and self-weaned children of Greece aged 0-36 months.
(Dec, 2012)
Growth of exclusively breastfed and self-weaned children of Greece aged 0-36 months.
(Dec, 2012)
[ 128 ]
National Trauma Institute
Updated:
(Feb 18, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Because trauma is a disease affecting all ages of people, the impact on life years... #1 for ... group 1-46, or 47% of all deaths in this ... range #3 as leading cause of death overall, across all ... groupsBurns4 (2013, most recent available) ...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Alcohol abuse and the injured host: dysregulation of counterregulatory mechanisms review.
(Mar, 2013)
Alcohol abuse and the injured host: dysregulation of counterregulatory mechanisms review.
(Mar, 2013)
[ 129 ]
Australian Institute of Health and Welfare
Updated:
(Jan 28, 2003)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Public Interest Disclosure Tenders  SubjectsBy category Ageing, disability & carers Families & children Hospitals Housing & homelessness Indigenous Australians Population groups Risk factors, diseases & death Services, workforce & spendingBy subject Adoptions Aged care Ageing Alcohol & other drugs Arthritis & musculoskeletal conditions Asthma...to release notices  By subject Adoptions Aged care Ageing Alcohol & other drugs AIHW annual reports Arthritis...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 130 ]
4D neonatal head models
Updated:
(Aug 18, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...standard atlas model that provides the necessary, ...-matched models of the brain and extra-cerebral tissues for pre-term and term ... infants that are necessary for accurate use...from 324 infants (160 female) between the ages of 27 and 47 weeks (post-menstrual ...).The infant head models available below will...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 131 ]
MEIERHOFER AG - MCC. Krankenhaus-Informationssystem
Updated:
(Apr 6, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...meierhofer text/html; charset=utf-8 MEIERHOFER AG - MCC. Krankenhaus-Informationssystem MEIERHOFER AG - Perspektiven erleben HomePortfolioKlinikinformationssystemFachlösungenUnternehmenReferenzenKarriereVeranstaltungenAktuellesKontaktService-PortalSucheMensch, Medizin...Produktspektrum Mit der strategischen Beteiligung der MEIERHOFER AG an der Berliner samedi GmbH baut der...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 132 ]
Publications - Church Lab
Updated:
(Oct 17, 2000)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Genome Resource: facilitating analyses of cancer and longevity-related adaptations. Bioinformatics pii: btu579. PMID: 25172923...JP (2014)Insights into the evolution of longevity from the bowhead whale genome. Cell Reports...J, Church GM (2009) Meta-analysis of ...-related gene expression profiles identifies common signatures of aging. Bioinformatics. Feb 2. PMID: 19189975185. Li JB...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Automation for genomics, part two: sequencers, microarrays, and future trends.
(Sep, 2000)
Automation for genomics, part two: sequencers, microarrays, and future trends.
(Sep, 2000)
[ 133 ]
WHO | WHO Mortality Database
Updated:
(Oct 3, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...is a compilation of mortality data by ..., sex and cause of death, as reported annually by Member States from their civil registration systems. Access the online databaseNumber of deaths and ...-standardized death rates by country, year, cause, sex and ... are presented in a user-friendly application...death data by country, year, sex and .... Data since 1950 to date as coded...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 134 ]
MIDUS - Midlife in the United States, A National Longitudinal Study of Health and Well-being
Updated:
(Nov 15, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...cognitive functioning contribute to changes in subjective ...., J Gerontol B Psychol Sci Soc...MIDUS NewslettersMIDJA (Midlife in Japan)Institute on Aging WebsiteNational Institute on Aging Website ©2011 University of Wisconsin - Madison, Institute on Aging...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Purpose in life predicts better emotional recovery from negative stimuli.
(2013)
Purpose in life predicts better emotional recovery from negative stimuli.
(2013)
[ 135 ]
MIDUS - Midlife in the United States, A National Longitudinal Study of Health and Well-being
Updated:
(Jan 5, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...change in adult mental health., Res Aging Andersson, M. ... , 2017,...MIDUS NewslettersMIDJA (Midlife in Japan)Institute on Aging WebsiteNational Institute on Aging Website ©2011 University of Wisconsin - Madison, Institute on Aging...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 136 ]
Welcome to the Health and Retirement Study
Updated:
(Apr 24, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Study A public resource for data on aging in America since 1990 For more than 20 years, the Health and Retirement Study (HRS) has been a leading source for information on the health and economic well-being of adults over ... 50 in the United States. We do...project sponsored by the National Institute on Aging (NIA U01AG009740) and the Social Security Administration...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 137 ]
Life Expectancy for CP, VS, TBI and SCI
Updated:
(Oct 28, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...below computes the survival prognosis based on ..., sex, and level of disability. These results...functioning = 5) This is only for patients aged 20 and older. See the publication for details on the groups, and limitations of the results. Sex: Male Female ...: (e.g. 42)Disability Group: Not Specified...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 138 ]
ELGA Calculator
Updated:
(Jul 15, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...-8 ELGA Calculator Extremely Low Gestational ... (ELGA) Calculator Short-term (23 - 28 weeks) Neonatal Morbidity and Mortality Outcomes Gestational ... (in completed weeks): 23 24 25 26 27 28 Gestational ... is required. Singleton or twin pregnancy: Singleton...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 139 ]
Hispanic Community Health Study/Study of Latinos: Sleep Apnea Risk Calculator
Updated:
(Jun 11, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Apnea Risk Calculator (Draft) Please provide Sex, ..., Height, Weight and Snoring Habit to obtain results. Sex MaleFemale ... years Height feet inches...cross-sectional data on Hispanic/Latino adults aged 18-74 years living in 4 U.S....
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 140 ]
1471-2105-10-5-S1
Updated:
(Jan 21, 2009)
Rate Avg:
(
no ratings
)
(
no ratings
)
...hyperparameters of the priors pd = pv = 1 ag = 2.0; bg = var0; ab = 1.0...0,ngene) temp3 = pv/(pi2)^nxy*bg^ag*gamma(nxy/2+ag)/gamma(ag) for (i in 1:ngene) { temp4 = (sum((x[i,]-ux[i])^2)+sum((y[i,]-ux[i]-d[i])^2))/2 temp1 = (1-pv)/(pi2*sqrt(var0))^nxy*exp(-temp4/var0) temp2 = temp3/(temp4+bg)^(nxy/2+ag) prob = temp2/(temp1+temp2) if (temp2 > 100000000...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Bayesian optimal discovery procedure for simultaneous significance testing.
(Jan 6, 2009)
Bayesian optimal discovery procedure for simultaneous significance testing.
(Jan 6, 2009)
[ 141 ]
Materiali e Strumenti di Ricerca | dpss.unipd.it
Updated:
(Feb 17, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...â by Manfrinati, Sarlo, & Lotto Objective ... of Acquisition (AoA) - by Lotto, Surian, & Job Download Objective ... of Acquisition (AoA) - Appendix A Download Objective ... of Acquisition (AoA) - Appendix B Pyscholinguistic Database...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Objective age of acquisition for 223 Italian words: norms and effects on picture naming speed.
(Feb, 2010)
Objective age of acquisition for 223 Italian words: norms and effects on picture naming speed.
(Feb, 2010)
[ 142 ]
SNP db
Updated:
(Sep 2, 2004)
Rate Avg:
(
no ratings
)
(
no ratings
)
...c T 2 5279 10956 558 ag aggctacatttgtctccagg acagcgttgtttgtgtttgt 1 11 80 a g A 2 5279 10834 680 ct agtagccagtctcctgttct agaagctggttgaatttgga 1 11 90 c t C 2 57977 376 707 at ctatccaacactaggttttc agccttgcagattttttctt 1 7 56 a t A 3 5279 10802 712 ag agtaatcttccagaaatgga aagcgcaagtaagtagccag 1 11 74 a g...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
An SNP resource for rice genetics and breeding based on subspecies indica and japonica genome alignments.
(Sep, 2004)
An SNP resource for rice genetics and breeding based on subspecies indica and japonica genome alignments.
(Sep, 2004)
[ 143 ]
AG Knapp
Updated:
(Apr 14, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...de/agknapp/ text/html; charset=utf-8 AG Knapp ContentNavigation HomeContactImpressumFreie Universität BerlinInstitute of Chemistry...Zacharias2014-12-16, 10:00 am (st)AG Wahl (Takustr. 6, 3.OG)Assessment of Binding Free Energy Calculations for Drug Design Nils Niggemann2014-05-15, 14:00 s.t.Semairraum der AG Wahl / Takustrasse 6 3. StockFast finite element...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 144 ]
Login for members:
Updated:
(Apr 30, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...small amounts of gluten at a young ... would prevent celiac disease, especially if this...B-36383âPREVENTCD). At the ... of 4 to 6 months, half of the children received 100 milligram of gluten daily. At the ... of 3 years 5.9 percent of...gluten for the first time at the ... of 6 months. In this group 4....
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 145 ]
The Naked Mole-Rat Genome Resource
Updated:
(Dec 4, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...of resistance to disease, and diseases of ageing in particular. It is the longest-lived rodent and is exceptionally resistant to neoplasia, making it a unique model for research on ageing and cancer as well as other traits...available to allow easy discovery of known ageing genes.BLAST searchFor searching sequences you can...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 146 ]
WebCite query result
Updated:
(Feb 19, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...not recruiting participants. Sponsor:National Institute on Aging (NIA)Information provided by (Responsible Party):National Institutes of Health Clinical Center (CC) ( National Institute on Aging (NIA) )ClinicalTrials.gov Identifier:NCT01331512First received: April...mobility difficulties that grow worse as they .... To better understand the reasons for mobility...original participants to assess the effects of aging on their mobility.Objectives:- To conduct a...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 147 ]
Welcome to the Elder Financial Abuse | Research and Training site
Updated:
(Feb 14, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Research Education Tools Resources ContactBrunel Institute for Ageing Studies has produced a series of resources...1). Copyright © 2012 Brunel Institute for Ageing Studies. You can find our sitemap here...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 148 ]
ShAPE-DALSP by JanHasenauer
Updated:
(Jul 30, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...and Parameter Estimation method (ShAPE) for Division-, ...- and Label-Structured Population (DALSP) modelsView on GitHub Download .zip Download .tar.gzFeaturesThe ShAPE-DALSP software package provides numerical methods for the simulation of division-, ...- and label-structured Population models. Furthermore, it...Allgöwer. Modeling and analysis of division-, ...-, and label-structured cell populations. In Proceedings...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 149 ]
ADNI Home ADNI Home
Updated:
(Apr 16, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...affects one in three people over the ... of 65. Alzheimerâs is currently...risk of Alzheimerâs increases with ..., and the U.S. population is aging.Since 2004, the longitudinal Alzheimerâs...potential intervention. ADNI is seeking people over ... 55, who are healthy, as well as...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 150 ]
LS Biologie der Mikroorganismen
Updated:
(Oct 15, 2007)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Biologie der MikroorganismenStartSekretariat MitarbeiterLehreForschungPublikationenRNA-SchwerpunktRNA-SURIBA AG Angewandte MikrobiologiEAktuelles Durchfallerreger misst KörpertemperaturMolekulares LegoCholera...32 23100Sprechstunde: Mi 10.00 - 11.00_______________________________AG Angewandte Mikrobiologie Prof. Dr. Julia Bandow Raum...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Genome-wide bioinformatic prediction and experimental evaluation of potential RNA thermometers.
(Nov, 2007)
Genome-wide bioinformatic prediction and experimental evaluation of potential RNA thermometers.
(Nov, 2007)
[ 151 ]
Welcome to AGED Atlas
Updated:
(Jul 7, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
26149169 http://plantgrn.noble.org/AGED/ text/html; charset=us-ascii Welcome to AGED Atlas Welcome to AGED The Alfalfa Gene Index and Expression Atlas...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 152 ]
Data and Methods - Comparative Biology Group
Updated:
(Sep 29, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...solexa sequencing data from 20 male individuals aged between 14 and 58 years [Dataset 2] Technical replication of Dataset 1 [Dataset 3] Biological replication from a single 25-year-old individual Estimating accuracy of RNA-Seq and microarrays with proteomics (2009)[Dataset 1] RNA-Seq data from 5 male individuals aged between 8 and 53 years. (The number...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 153 ]
Welcome to the Millennium Cohort Study - Centre for Longitudinal Studies
Updated:
(Dec 25, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...cohort members carried out so far – at ... nine months, three, five, seven and eleven years – have built up a uniquely detailed portrait of the children of the new century. The ... 11 Survey took place place in 2012...pages. CLS is currently carrying out the ... 14 survey, which is in field throughout 2015/early 2016. CLS will also carry out a new survey of the MCS cohort at ... 17 in 2018. The data The data...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 154 ]
Citrus Canker: The Pathogen and Its Impact
Updated:
(Jun 22, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...branches up to a few years of ... (Fig. 21). Bacteria that ooze onto plant...to appear (22,58). As the lesions ..., they first turn light tan, then tan-to-brown, and a water-soaked margin appears, often surrounded by a chlorotic halo (Fig. 22). The water-soaked margin may disappear as lesions ..., and is not as prominent on resistant...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Xanthomonas axonopodis pv. citri: factors affecting successful eradication of citrus canker.
(Jan 1, 2004)
Xanthomonas axonopodis pv. citri: factors affecting successful eradication of citrus canker.
(Jan 1, 2004)
[ 155 ]
Alberta Agriculture and Forestry
Updated:
(Jun 24, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...wanted to know about traceability, how to ... verify your calvesLearn more about completing the...you have an agricultural question? Call the Ag-Info Centre at 310-FARM (3276), toll free in Alberta.Spring Termination of Hayland Land Rental Spring Grazing Soil Temperature and Field Vegetable Germination More FAQs...InformationCropsLivestockAg EngineeringBusiness & EconomicsDiseases/Insects/ PestsFood & Ag ProcessingFood SafetyLearning & 4HMinistry InformationRural ServicesSoil/Water/AirStatisticsTradeWeather...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 156 ]
WHO | Breastfeeding
Updated:
(Sep 3, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...is recommended up to 6 months of ..., with continued breastfeeding along with appropriate complementary foods up to two years of ... or beyond. General informationWorld Breastfeeding Week 2016Q&A: Up to what ... can a baby stay well nourished by...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
The transfer of drugs and therapeutics into human breast milk: an update on selected topics.
(Sep, 2013)
The transfer of drugs and therapeutics into human breast milk: an update on selected topics.
(Sep, 2013)
[ 157 ]
WebCite query result
Updated:
(Jan 27, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Accidents- Inclusion criteriaParents of children in the ... of 7 months (range 6-8 months...Safety Institute in the Netherlands for children aged 1-2 years (control group). Parents receive...child visit at the child¡¦s ... of 11 months. - Primary outcomeParents¡¦ child...most important cause of death among children aged 0-4 years old. It is also a great source of morbidity and loss of quality of life. In the Netherlands each year 24 children aged 0-4 years die caused by injuries in around the home. Additionally 44.000 children aged 0-4 years are medically treated, of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 158 ]
hsgsim.org - Hochschulgruppe Simulation
Updated:
(May 22, 2008)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Vordergrund.ArbeitsgruppenDynamische Simulation von Belebtschlammanlagen Hauptziel der AG "Dynamische Simulation von Belebtschlammanlagen" ist es, die Akzeptanz der dynamischen Simulation in der Praxis zu erhöhen. Integrierte ModellierungZiel der AG "Integrierte Modellierung" ist es, die Anwendung integrierter...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Generation of diurnal variation for influent data for dynamic simulation.
(2008)
Generation of diurnal variation for influent data for dynamic simulation.
(2008)
[ 159 ]
healthsentry.net
Updated:
(Sep 26, 2003)
Rate Avg:
(
no ratings
)
(
no ratings
)
...allwaysync.com/promo#1 Worst ExerciseIt causes aging and weight-gain! Learn how to slow aging & burn fat www.maxworkouts.comBuy Dental HandpiecesNew...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 160 ]
Sealed Envelope | BWHHS Prognostic model for incident locomotor disability in older adults
Updated:
(Feb 25, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...based on two British prospective cohort studies. ... and Ageing 2015; 44: 275-282. Online calculator by...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 161 ]
Pictures and norms for psycholinguistic studies
Updated:
(May 1, 2003)
Rate Avg:
(
no ratings
)
(
no ratings
)
...agreement, conceptual familiarity, visual complexity, image variability, ... of acquisition, and naming latencies http://leadserv...agreement, conceptual familiarity, visual complexity, image variability, ... of acquisition, and naming latencies" by ...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 162 ]
Biosystems Data Analysis Group
Updated:
(Jun 6, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...W. B. Hendriks, Paul H. C. Eilers, ... K. Smilde and Huub C. J. Hoefsloot...Ferdinand Roelfsema, Jan van der Greef, and ... K. Smilde Am J Physiol Endocrinol Metab...van Velzen, Huub C. J. Hoefsloot and ... K. Smilde Metabolomics: Springer link date 30...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
How informative is your kinetic model?: using resampling methods for model invalidation.
(2014)
How informative is your kinetic model?: using resampling methods for model invalidation.
(2014)
[ 163 ]
ORION fold recognition
Updated:
(Nov 21, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...dsimb.inserm.fr/ORION/References de Brevern, A.G., Etchebest, C., and Hazout, S. 2000. Bayesian probabilistic approach for predicting backbone structures in terms of protein blocks. Proteins 41: 271-287.Ghouzam Y, Postic G, de Brevern AG, Gelly JC. Improving protein fold recognition with...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 164 ]
Benefit-Harm-Balance Calculator
Updated:
(Oct 1, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...harm chart shows, per women and men, ... category and according to 10-year outcome...if you are interested in a particular ... category 45-5455-6465-7475-84 Please...in %10-year risk for MI in %... 45-54>12%-15% ...-10%>10% -15%>15% -20%>20% -25%... 55-64>12%-15% ...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 165 ]
RCT Tagger
Updated:
(Jun 6, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Adult: 19-24 yearsAdult: 19-44 yearsMiddle Aged + Aged: 45+ yearsMiddle Aged: 45-64 yearsAged: 65+ years80 and over...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 166 ]
BioPhysConnectoR - AG Hamacher - Technische Universitaet Darmstadt
Updated:
(May 12, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...BioPhysConnectoR/ text/html; charset=us-ascii BioPhysConnectoR - AG Hamacher - Technische Universitaet DarmstadtDirekt zum InhaltTUD | Bio at TUD | AG HamacherHomeHome About Us License Documentation Download Publications Change Log AG Hamacher (ext.) BioPhysConnectoR Connecting Biology & Physics in...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
BioPhysConnectoR: Connecting sequence information and biophysical models.
(2010)
BioPhysConnectoR: Connecting sequence information and biophysical models.
(2010)
[ 167 ]
Plateforme GeT-Biopuces
Updated:
(Aug 28, 2008)
Rate Avg:
(
no ratings
)
(
no ratings
)
...de GeTAccès qPCR Biomark, séquençages Illumina, Pacbio et Sanger, ainsi qu'Ã...agebiologisteNathalie Marsaud Réalisation Services Séquenç... et Biopuces AffymetrixbiologisteDelphine Labourdette Design de microarrays...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 168 ]
jcb.201301001
Updated:
(Aug 6, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...with 2 ml of 3â5% aged thioglycollate solution. On day 5 after injection...to pancreatic cancer by inhibiting oncogene-induced senescence. Cancer Cell. 19:728â739. doi...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Macrophages in pancreatic cancer: Starting things off on the wrong track.
(Aug 5, 2013)
Macrophages in pancreatic cancer: Starting things off on the wrong track.
(Aug 5, 2013)
[ 169 ]
Systolic Blood Flow in the MCA
Updated:
(Feb 21, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...the MCA as a Function of Gestational ... Home > Calculators > MCA Peak Systolic VelocityThe...times the median or higher.ENTER:Gestational ... (weeks) Observed MCA Peak Systolic Velocity (cm/sec) Calculations: The Median Peak Systolic Velocity for this ... is Your measurement is Multiples...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 170 ]
FUTURAGE :: Final Road Map
Updated:
(Jul 16, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Road MapFinal Road MapRoad Map for European Ageing ResearchThe FUTURAGE Road Map for European Ageing Research can be downloaded here.A browsable...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 171 ]
aep.lib.rochester.edu
Updated:
(Feb 6, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...and more. AIDS touches individuals of all ages. On this website you will find posters...AIDS continues to affect people of all ages around the world, the purposes for which...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 172 ]
PrediQt: A Post treatment Quality of Life prediction model for cervical cancer.
Updated:
(Mar 3, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...appear at the bottom of the page....(in years):MarriedVaginal Bleeding Present:yesnoVaginal Discharge Present:yesnoDyspareunia (Painful Intercourse)Abdominal Pain:PresentAbsentSignificant Weight LossParity (number of pregnancies carried to viable gestational ...):Nullipara-never given birthPrimipara-given birth onceMultipara...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 173 ]
Data | Injury Biomechanics Laboratory
Updated:
(Jan 29, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...dimensional average head contours are available for ages ranging between one-month and ten-year-old specimens. Data is formatted as an .stl surface mesh, or a text file containing point coordinates. Contours for each ... group include separate average male and female...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 174 ]
UOMO - The European Prostate Cancer Coalition UOMO - The European Prostate Cancer Coalition
Updated:
(Apr 16, 2007)
Rate Avg:
(
no ratings
)
(
no ratings
)
...If you are male and above the ... of 45, or have a male relative of that ..., you should read thisHome Our MembersEuropa Uomo...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 175 ]
www.regstattools.org
Updated:
(Jan 8, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...number of cases (or deaths), for separate ...-groups (e.g. 5 years) and the...the person-years at risk for each ... group considered. Once the dataset has been...We reccomend to be at least 2 ... groups to perform RiskDiff, otherwise there is no evolution of the ... structure and changes can be only attributed...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 176 ]
Genomic Paris Centre - IBENS
Updated:
(May 22, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...seq chez tous les eucaryotes. Séquenç... à haut débitVos échantillons sont...allons effectuer des tests de séquenç... des ARNm pleine longueur. EMPLOIS & FORMATIONSStage de Master11/10/2016Développement dâun outil dâanalyse RNA-Seq combinant le séquenç... Illumina et Oxford Nanopore PUBLICATIONSCell Discovery2017Translation in...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Eoulsan: a cloud computing-based framework facilitating high throughput sequencing analyses.
(Jun 1, 2012)
Teolenn: an efficient and customizable workflow to design high-quality probes for microarray experiments.
(Jun, 2010)
AffyGCQC: a web-based interface to detect outlying genechips with extreme studentized deviate tests.
(Apr, 2008)
Computational and experimental approaches double the number of known introns in the pathogenic yeast Candida albicans.
(Apr, 2007)
Doelan: a solution for quality control monitoring of microarray production.
(Nov 15, 2005)
MiCoViTo: a tool for gene-centric comparison and visualization of yeast transcriptome states.
(Mar 3, 2004)
Arrayplot for visualization and normalization of cDNA microarray data.
(Jun, 2002)
yMGV: a database for visualization and data mining of published genome-wide yeast expression data.
(Jul 1, 2001)
Transcriptomes, transcription activators and microarrays.
(Jun 8, 2001)
Eoulsan: a cloud computing-based framework facilitating high throughput sequencing analyses.
(Jun 1, 2012)
Teolenn: an efficient and customizable workflow to design high-quality probes for microarray experiments.
(Jun, 2010)
AffyGCQC: a web-based interface to detect outlying genechips with extreme studentized deviate tests.
(Apr, 2008)
Computational and experimental approaches double the number of known introns in the pathogenic yeast Candida albicans.
(Apr, 2007)
Doelan: a solution for quality control monitoring of microarray production.
(Nov 15, 2005)
MiCoViTo: a tool for gene-centric comparison and visualization of yeast transcriptome states.
(Mar 3, 2004)
Arrayplot for visualization and normalization of cDNA microarray data.
(Jun, 2002)
yMGV: a database for visualization and data mining of published genome-wide yeast expression data.
(Jul 1, 2001)
Transcriptomes, transcription activators and microarrays.
(Jun 8, 2001)
[ 177 ]
eldermet.ucc.ie
Updated:
(Jul 19, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...defense mechanisms or immune system. As people ..., these beneficial properties of the gut bacteria...expertise from ELDERMET are contributing to NU-... which is a large multidisciplinary consortium with...for Research and Technological Development. The NU-... project aims to explore how diet can... technologies. For more information on NU-... please click on the logo below.ELDERFOOD...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 178 ]
.regstattools.net
Updated:
(May 15, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...1) descriptive analysis of frequencies (Crude Rates, ...-Standardized. Truncated Rates, Cumulative Risk) 2) Annual percent change of ...-standardized rates 3) Standardized incidence or mortality...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 179 ]
Tools for Epilepsy | Appropriateness Study of Epilepsy Surgery
Updated:
(Aug 30, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...epilepsy surgery.Epilepsy affects people of all ages, gender, and socio-economic status.Epilepsy affects people of any ..., gender, and race or ethnicity. Years of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Development of an online tool to determine appropriateness for an epilepsy surgery evaluation.
(Sep 11, 2012)
Development of an online tool to determine appropriateness for an epilepsy surgery evaluation.
(Sep 11, 2012)
[ 180 ]
DIANA TOOLS - microT-CDS
Updated:
(Jun 24, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Reczko M, Filippidis C, Dalamagas T, Hatzigeorgiou AG., "DIANA-microT web server v5.0: service integration into miRNA functional analysis workflows.", Nucleic Acids Res. 2013 Jul;41(Web Server issue):W169-73.• Reczko M, Maragkakis M, Alexiou P, Grosse I, Hatzigeorgiou AG., "Functional microRNA targets in protein coding sequences...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
DIANA-microT web server v5.0: service integration into miRNA functional analysis workflows.
(Jul, 2013)
DIANA-microT web server v5.0: service integration into miRNA functional analysis workflows.
(Jul, 2013)
[ 181 ]
Danubian Biobank Consortium
Updated:
(Mar 31, 2008)
Rate Avg:
(
no ratings
)
(
no ratings
)
...objective(s) and state of the art Aging disorders related to vascular medicine and metabolic...for public utility in molecular medicine of aging disorders " that networks and expands all biobanking activities and the core scientific competences of the Danubian universities, teaching hospitals and rehabilitation clinics between Ulm and Budapest and of associated collaborating regional centers in the field of non-cancer aging disorders. In this context we will address...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 182 ]
Home
Updated:
(Feb 8, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Biosciences & ApplicationsNational Center for Scientific Research "Demokritos", Ag. Paraskevi 15310, Athens-Greece v.1....BIOSCIENCES & APPLICATIONS, N.C.S.R. âDEMOKRITOSâ, Ag. Paraskevi-Athens, Greece Tuesday the 2nd. Joomla...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Gromita: a fully integrated graphical user interface to gromacs 4.
(Sep 7, 2009)
Gromita: a fully integrated graphical user interface to gromacs 4.
(Sep 7, 2009)
[ 183 ]
Enhancing Neuro Imaging Genetics Through Meta Analysis
Updated:
(Aug 1, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...turn, those tracts show exacerbated decline with aging. (Read more; run the program; download source code on the NITRC website)Heterochronicity of White Matter Development and Aging and Vulnerability to SchizophreniaKochunov Peter, Ganjgahi Halib...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 184 ]
Fertility: Overview, 2009 to 2011
Updated:
(Jan 5, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...2011. In addition to the number of births, indicators analysed include the total fertility rate, ...-specific fertility rates, average ... of mother at childbirth, birth order, and completed fertility. When possible, recent trends are also...a woman would have over the course of her reproductive life if she experienced the ...-specific fertility rates observed in a particular calendar year. It is based on a compilation...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 185 ]
168
Updated:
(Sep 19, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...enhance arf2 phenotype, i.e., delayed leaf senescence resulting in more and larger leaves[77...regions determining enhanced leaf growth and delayed senescence in elevated CO2. Plant Cell Environ. 2006...Wilhelm WW, Nelson CJ. Leaf growth, leaf aging, and photosynthetic rate of tall fescue genotypes...mutants reveal functions in shoot growth, leaf senescence, seed size, germination, root development, and cytokinin...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 186 ]
Neurodevelopmental MRI Database
Updated:
(Nov 17, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...based averages. The data are separated by ages in months, years, 6-month, or 5-year intervals (Ages and Templates). The templates are grouped into...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 187 ]
Aurora-Project.eu
Updated:
(Jun 19, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...after breast cancer, among young European women aged 15-44. According to IARC estimates for...the majority of cases appear between the ages of 35 and 50, when women are...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 188 ]
WormExp: Home
Updated:
(May 7, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...in C. elegans research, e.g. immunity, aging, development, food and stress response. Current version...TF Targets #161 Tissue #91 Development/Dauer/Aging #96 DAF/Insulin/food #146 Chemicals/stress...development, including the dauer stage, and during aging. DAF/Insulin/foodDifferentially expressed genes in mutants...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 189 ]
ORION web server
Updated:
(Jun 20, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...articles.ReferencesGhouzam Y, Postic G, de Brevern AG, Gelly JC. Improving protein fold recognition with hybrid profiles combining sequence and structure evolution. Bioinformatics 2015, 31: 3782-9.Ghouzam Y, Postic G, Guerin PE, de Brevern AG, Gelly JC. ORION: a web server for...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 190 ]
University of Iowa Rectal Surgery Risk Calculator
Updated:
(May 8, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...calculator requires numerical entries for White Count, ..., and Hematocrit to work.The risk model applies only to patients over 18 years of ... and excludes patients undergoing emergency procedures. The...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 191 ]
Manitoba Follow-up Study Home Page
Updated:
(Jul 16, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...SPECTATORARCHIVED STORIES Researchers interested in Successful Aging click here...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Older men's lay definitions of successful aging over time: the Manitoba follow-up study.
(2013)
Older men's lay definitions of successful aging over time: the Manitoba follow-up study.
(2013)
[ 192 ]
BahlerLab: Home
Updated:
(Nov 6, 2006)
Rate Avg:
(
no ratings
)
(
no ratings
)
...laboratory studies genome regulation during cellular quiescence, ageing and stress response using fission yeast as...Genetics Institute, and the Institute of Healthy Ageing. Our research is mainly funded by a...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Simplified primer design for PCR-based gene targeting and microarray primer database: two web tools for fission yeast.
(Oct 15, 2006)
YOGY: a web-based, integrated database to retrieve protein orthologs and associated Gene Ontology terms.
(Jul 1, 2006)
Correlations between gene expression and gene conservation in fission yeast.
(Dec, 2003)
Simplified primer design for PCR-based gene targeting and microarray primer database: two web tools for fission yeast.
(Oct 15, 2006)
YOGY: a web-based, integrated database to retrieve protein orthologs and associated Gene Ontology terms.
(Jul 1, 2006)
Correlations between gene expression and gene conservation in fission yeast.
(Dec, 2003)
[ 193 ]
Bayesian Bonetumor Probabilities
Updated:
(Oct 10, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...calculations provided herein. select sex femalemale select ... group (years) 01-45-910-1415-1920...metaphysealepi-meta-diaphysealmetaphysealmeta-diaphysealdiaphysealselect tumors to compare ..., localization and sex adjusted relative pretest probabilitieschondroblastic...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 194 ]
Pharmaceuticals | Bayer - Home
Updated:
(Feb 14, 2005)
Rate Avg:
(
no ratings
)
(
no ratings
)
...and trendsCommitment + ResponsibilityEthics and transparencyFamily planningNeglected diseasesHealthy aging Bayer GlobalProductsMediaInvestorsCareersContact UsReport A Side EffectDeutschBayer GlobalProductsMediaInvestorsCareers...re helping to fight it. Healthy aging Bayer to Acquire Monsanto Information about Bayer...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 195 ]
Olfactory coding in insects - AG Galizia - Universität Konstanz
Updated:
(Feb 25, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...charset=us-ascii Olfactory coding in insects - AG Galizia - Universität Konstanzhttp://neuro.uni-konstanz...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Integrating heterogeneous odor response data into a common response model: A DoOR to the complete olfactome.
(Sep, 2010)
Integrating heterogeneous odor response data into a common response model: A DoOR to the complete olfactome.
(Sep, 2010)
[ 196 ]
www.simonsz.net
Updated:
(Sep 16, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...2.1 (CSM21.zip)Predictive value of ..., angle, and refraction on reoperation and resolution...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 197 ]
Forensic ChrX Research
Updated:
(Jun 19, 2006)
Rate Avg:
(
no ratings
)
(
no ratings
)
...klicken Sie bitte hier. © 2011 Qualitype AG...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
A new Web site compiling forensic chromosome X research is now online.
(Jul, 2006)
A new Web site compiling forensic chromosome X research is now online.
(Jul, 2006)
[ 198 ]
Drumpid - Index
Updated:
(Apr 8, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...them. Meik Kunz, Chunguang Liang, Alex Cecil, AG Dandekar, Department of Bioinformatics, University of Wuerzburg...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 199 ]
Home - Nuffield Bioethics
Updated:
(Dec 14, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...research in global health emergenciesWorkshop: ethics of ageing researchPrevious workNaturalnessBiological and health dataThe culture of...maintaining human embryos in researchWorkshop: ethics of ageing researchWorkshop: research in global health emergenciesCosmetic proceduresGenome...slow or prevent the biological processes of ageing â …The Council held a workshop...human embryos in culture.Workshop: ethics of ageing researchThe Council held a workshop in November 2016 to consider the ethical, social and policy issues raised by research that seeks to slow or prevent the biological processes of ageing â …Workshop: research in global health...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 200 ]
Start
Updated:
(Oct 21, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...ZieleDas KnorpelRegister DGOU ist eine Initiative der AG Klinische Geweberegeneration der DGOU. Nach vorausgehender Vorbereitungszeit...und Ellenbogenchirurgie (DVSE)Weitere TermineNewsStudiensekretariat FreiburgSitzung der AG Klinische Geweberegeneration auf dem DKOU 2016Aus organisatorischen...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 201 ]
downloads
Updated:
(Sep 30, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...wir1_HC2Gene set file with point mutations (...) used in the analysis SomaticMutations.GBM_OV...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 202 ]
Eczema | RCPCH
Updated:
(Nov 4, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...cheeks and/or extensor areas in children aged 18 months or under) personal history of dry skin in the last 12 months personal history of asthma or allergic rhinitis (or history of atopic disease in a first degree relative of children aged under four years) onset of signs and symptoms under the ... of two years (this criterion should not...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Emollients, education and quality of life: the RCPCH care pathway for children with eczema.
(Nov, 2011)
Emollients, education and quality of life: the RCPCH care pathway for children with eczema.
(Nov, 2011)
[ 203 ]
GFR Calculator
Updated:
(Oct 25, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...times \textrm{INR}^{-0.113} \\ && \times \left( \textrm{...}^{-0.129} \left[ \textrm{years} \right] \right) \times \left( \textrm{sodium}^{0.972} \left[ \frac{\textrm{mmol}}{L} \right] \right) \\ && \times 1.236 \, (\textrm{if male}) \\ && \times 0.92 \, \left( \textrm{if} \, \frac{\textrm{moderate}}{\textrm{severe}} \, \textrm{ascites} \right) \ \end{eqnarray} $$ Units SIC (US)Gender Female Male ... yearsAscites Moderate or Severe Yes Creatinine Urea...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 204 ]
Algorithms in Bioinformatics
Updated:
(Sep 24, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Arriola, L, Llamas, B, Breen, J, Morris, AG, Alt, KW, Caramelli, D, Dresely, V, Farrell, M, Farrer, AG, Francken, M, Gully, N, Haak, W, Hardy...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 205 ]
AnnoTrack
Updated:
(Oct 13, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...splice_AT_AC_weak47 splice_GC_AG_alnDiff109 splice_GC_AG_none157 splice_GC_AG_suspect17 splice_GC_AG_weak1562 splice_GT_AG_alnDiff1583 splice_GT_AG_none2702 splice_GT_AG_suspect1853 splice_GT_AG_weak61937 splice_gap_alnDiff5 splice...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 206 ]
Submit Dictionary Words | Merriam-Webster
Updated:
(Feb 13, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Alphabetically: AhABCDEFGHIJKLMNOPQRSTUVWXYZotherAa Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An...15:04ABCDEFGHIJKLMNOPQRSTUVWXYZotherAa Ab Ac Ad Ae Af Ag Ah Ai Aj Ak Al Am An...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 207 ]
CCSMH - Canadian Coalition for Seniors' Mental Health
Updated:
(Dec 19, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...encountered in older persons. Compared to similarly aged individuals, older hospitalized persons who are delirious...000 in 1996 (National Advisory Council on Aging, 1999) and this number is continuing to...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Developing guidelines on the assessment and treatment of delirium in older adults at the end of life.
(Jun, 2011)
Developing guidelines on the assessment and treatment of delirium in older adults at the end of life.
(Jun, 2011)
[ 208 ]
NITRC: Generation R Pediatric MRI Resources: Tool/Resource Info
Updated:
(Jul 15, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...respect to spatial normalization/registration. An average, ...-appropriate T1-weighted image, constructed from 130 typically developing children ages 6-to-10, is available. Further, a set of 25 resting-state ICA components are made available. The components were generated from 536 typically developing children, ages 6-to-10 years old. The components...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 209 ]
1471-2105-8-147-S4
Updated:
(Jun 5, 2007)
Rate Avg:
(
no ratings
)
(
no ratings
)
...06046 AITV 1.06046 LW 1.06046 AG 0.772779 E 0.654996 ADEG 0....-4 KQR -4 AKQR -4 DES -4 ... -4 DEGS -4 DEKS -4 GNS -4...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 210 ]
gpc-ag.com
Updated:
(Oct 17, 2000)
Rate Avg:
(
no ratings
)
(
no ratings
)
10958641 http://www.gpc-ag.com/win.html text/html; charset=utf...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Tissue gene expression analysis using arrayed normalized cDNA libraries.
(Aug, 2000)
Tissue gene expression analysis using arrayed normalized cDNA libraries.
(Aug, 2000)
[ 211 ]
AAAS | Science's SAGE KE | Genes/Interventions Database
Updated:
(Jun 4, 2002)
Rate Avg:
(
no ratings
)
(
no ratings
)
...to their effects on life-span or ...-related neurological diseases. On 18 September 2006...Advertise | Find Products Science of Aging Knowledge Environment. ISSN 1539-6150 News ...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 212 ]
Printed Word Database for 5-9 Year Olds - Home
Updated:
(Apr 7, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...printed word frequencies as read by children aged between 5 & 9.SEARCH THE DATABASEHistory ~...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Children's printed word database: continuities and changes over time in children's early reading vocabulary.
(May, 2010)
Children's printed word database: continuities and changes over time in children's early reading vocabulary.
(May, 2010)
[ 213 ]
GoPubMed® - Transinsight's semantic search for the life sciences
Updated:
(Jun 27, 2005)
Rate Avg:
(
no ratings
)
(
no ratings
)
...million Research Report 2.0 million Middle Aged 1.0 million Medicalization 0.8 million...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 214 ]
display_record.asp?ID=CRD42014008928
Updated:
(Apr 18, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...height measurement to predict small-for-gestational-... infants: a systematic review PROSPERO International prospective register of systematic reviews Symphysis-fundus height measurement to predict small-for-gestational-... infants: a systematic review Aase Serine Devold...height measurement to predict small-for-gestational-... infants: a systematic review. PROSPERO 2014:CRD42014008928...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 215 ]
Osteosarcoma and metastasis
Updated:
(Jul 22, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...adults. Teens are the most commonly affected ... group, but osteosarcoma can occur at any .... In this way, osteosarcoma is the most...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 216 ]
Merlin
Updated:
(Jun 17, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...html; charset=us-ascii Merlin MerlinAboutDemoQuick StartCIDARGITHUBMerlinM.A.G.E Optimization toolDeveloped by CIDAR BUGiven an...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 217 ]
Rosy Sarmah
Updated:
(Oct 23, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Spatial Data Analysis" published by Verlag DM AG & Co, KG, Germany.Read more...© 2012...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 218 ]
AERS Spider
Updated:
(Jul 29, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...consideration suspicious risk factors (indications, other drugs, ... groups). In addition, for the "drug to...mask" factors. By definition, all factors (indications, ... groups, and other drugs) with PRR value...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 219 ]
Social Environment and Biomarkers of Aging Study (SEBAS) in Taiwan, 2000 and 2006
Updated:
(Mar 18, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...studies/3792/version/5 text/html; charset=iso-8859-1 Social Environment and Biomarkers of Aging Study (SEBAS) in Taiwan, 2000 and 2006Skip to Main ContentToggle navigation National Archive of Computerized...NotesDataset(s)Study DescriptionCitationFundingScope of StudyMethodologyVersion(s)Related PublicationsUtilitiesMetadata ExportsDownload StatisticsSocial Environment and Biomarkers of Aging Study (SEBAS) in Taiwan, 2000 and 2006 (ICPSR 3792) Principal Investigator(s): Weinstein, Maxine, Georgetown...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 220 ]
Computational Biochemistry Group (Bayreuth)
Updated:
(Sep 21, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...for Aligning Type II Reaction Center Sequences AG Ullmann...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 221 ]
WebCite query result
Updated:
(Jul 22, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...change?2. Does the efficacy vary with ...?3. Does the efficacy vary by the...obesityParticipants/ populationParents or carers of children/adolescents aged 0-18 years who are overweight or...group, characteristics of participants and children/adolescents (..., gender), setting, weight, height, BMI, percentage body...type of eHealth modality used and participant ... were not conducted due to the small number of studies and the wide range of ages within the individual studies making it difficult to analyse different ... groups (updated 26/08/15).Dissemination plansWe...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 222 ]
Stroke Risk Estimator After TIA - The CIP Model
Updated:
(Dec 30, 2008)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Risk Estimator After TIAThe CIP Model1. ... ≥ 60 years Yes No2. History...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Clinical- and imaging-based prediction of stroke risk after transient ischemic attack: the CIP model.
(Jan, 2009)
Clinical- and imaging-based prediction of stroke risk after transient ischemic attack: the CIP model.
(Jan, 2009)
[ 223 ]
NFINgb - Nothobranchius furzeri Genome Browser
Updated:
(Dec 7, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Analysis group of the Leibniz Institute on Aging - Fritz Lipmann Institute. The following genome assemblies...al.: Insights into Sex Chromosome Evolution and Aging from the Genome of a Short-Lived...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 224 ]
WHO | Tools for the prevention and control of NCDs
Updated:
(Aug 14, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...mortality Physical inactivityIndicator 6: AdolescentsIndicator 7: Persons aged 18+ years Salt/sodium intakeIndicator 8: Intake of salt Tobacco useIndicator 9: AdolescentsIndicator 10: Persons aged 18+ years Raised blood pressureIndicator 11: Prevalence among persons aged 18+ years Diabetes and obesityIndicator 12: DiabetesIndicator 13: Obesity in adolescentsIndicator 14: Obesity in persons aged 18+ years Additional indicatorsIndicator 15: Saturated fatty...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 225 ]
WebCite query result
Updated:
(Dec 16, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...search you can use filters for Country, ... Group, Gender, Trial Phase, Trial Status, Date Range, Rare Diseases and Orphan Designation. For these items you should use the filters and not add them to your search terms in the text field. Advanced Search:Search toolsSelect Country:AustriaBelgiumBulgariaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHungaryIcelandIrelandItalyLatviaLiechtensteinLithuaniaLuxembourgMaltaNetherlandsNorwayPolandPortugalRomaniaSlovakiaSloveniaSpainSwedenUnited KingdomOutside EU/EEASelect ... Range:AdolescentAdultChildrenElderlyIn-UteroInfant and ToddlerNewbornPreterm new born...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 226 ]
JANE - EST Analyzer
Updated:
(Dec 7, 2009)
Rate Avg:
(
no ratings
)
(
no ratings
)
...WuBLAST2KEGGExPASyBack on top ^ © 2008 Copyright Dandekar AG 2008, Uni. Wuerzburg - Powered by bioapt studio...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 227 ]
ISRCTN - ISRCTN37687716: PROmotion of Breastfeeding Intervention Trial
Updated:
(Jan 21, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...were followed at regular intervals until the infants were 12 months of .... Detailed information was recorded at each follow-up visit about infant feeding...blood pressure, behaviour, dental health, intelligence quotient (IQ), asthma and allergy. At ... 11 and a half years, 13,879 (81%) were again examined for height, weight, body fat, blood pressure, and also had blood tests to measure diabetes and heart disease risk factors. Currently we are seeing the children at ... 16 years. Who can participate?Recruitment is complete. Mothers and their babies...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 228 ]
searchresult.php?id=3930&number=32
Updated:
(Aug 31, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...exclusion criteria : Inclusion criteria: children and adolescents aged 5 to 18 years; total score of YGTS more than 21. Exclusion criteria: Marked general medical condition; hypersensitivity to the medications. Minimum ... : Year: 5 Maximum ... : Year: 18 ...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 229 ]
All Our Ideas - Bringing survey research into the digital age
Updated:
(May 21, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Ideas - Bringing survey research into the digital ... HomeCreateAboutBlogLog InBringing survey research into the digital .... Mix core ideas from survey research with...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 230 ]
AAPPred: B-cell eptitope prediction
Updated:
(Apr 1, 2009)
Rate Avg:
(
no ratings
)
(
no ratings
)
...AAPPred. Please cite us: Ya.I. Davydov, A.G. Tonevitsky, 2009, published in Molekulyarnaya Biologiya, 2009...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 231 ]
EDMS homepage
Updated:
(Jan 29, 2004)
Rate Avg:
(
no ratings
)
(
no ratings
)
...in real-world applications. Charlotte, NC: Information ... Publishing.> McNeish, D., & Harring, J. R....teacher and school effectiveness. Charlotte, NC: Information ... Publishing, Inc.> Stapleton, L. M., Pituch, K....real-world applications. Charlotte, NC: Information ... Publishing, Inc.> Harring, J. R., Beretvas...real-world applications. Charlotte, NC: Information ... Publishing, Inc.> Stapleton, L. M.,...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 232 ]
Prevention of Falls Network Europe
Updated:
(Sep 2, 2005)
Rate Avg:
(
no ratings
)
(
no ratings
)
...9PL Great Britain Key Action 6.4: Ageing Population and Disabilities EC contract QLK6-CT...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 233 ]
Computational Biochemistry Group (Bayreuth)
Updated:
(Feb 22, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...computational biology, bioinorganic chemistry, and structural biology. AG Ullmann...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
GMCT : A Monte Carlo simulation package for macromolecular receptors.
(Mar 30, 2012)
GMCT : A Monte Carlo simulation package for macromolecular receptors.
(Mar 30, 2012)
[ 234 ]
European research in action - Diabetes
Updated:
(Dec 1, 2008)
Rate Avg:
(
no ratings
)
(
no ratings
)
...in 20 languages.DiabetesNew insights into an ...-old enemy +Overview+Children at...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 235 ]
GAMDB
Updated:
(Apr 10, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...gerontology-related miRNA, can be applied for aging disease or autophagy researches as a bioinformatic...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 236 ]
Welcome to MARMAL-AID
Updated:
(Dec 31, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...as investigating methylation sites across development and aging. We provide functions to easily plot large...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 237 ]
ISRCTN48134476
Updated:
(Jan 10, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Mental Wellbeing Scale (WEMWBS). Co-variates are: ..., sex, educational level, employment status, ethnic group...self-rated general health. Co-variates are: ..., sex, educational level, employment status, ethnic group...outcome measures for the following subgroups: 1. ... groups: we have an a priori hypothesis that MoodGYM may be of more benefit to a young ... group as it was originally developed for this group. We will therefore undertake a subgroup analysis for the ... group aged 25 and younger (and compare with the...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 238 ]
WebCite query result
Updated:
(Mar 4, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...as of 29/04/2008: All participants aged 18 or over and scoring 5 or more on the AUDIT-C screening test. Previous inclusion criteria: All registrants of the How's Your Drink (HYD) website (aged 16 or over) with a functional assessment...participants who are under 18 years of ... 2. Inability to provide informed consent due...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Impact and costs of incentives to reduce attrition in online trials: two randomized controlled trials.
(Mar 2, 2011)
Impact and costs of incentives to reduce attrition in online trials: two randomized controlled trials.
(Mar 2, 2011)
[ 239 ]
CTRI
Updated:
(Jul 14, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...improving the growth outcomes at term corrected .... Secondary IDs if Any Secondary...baby will be followed till post menstrual ... of 40 weeks of gestation.During this period, mothers will be encouraged to do KMC for at least 6 hours. Comparator Agent Late Kangaroo mother care Late Kangaroo mother care once the infant reaches a weight of 1250grams.baby will be followed till post menstrual ... of 40 weeks of gestation.During this...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 240 ]
WebCite query result
Updated:
(May 21, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...study. Eligibility Key inclusion criteria 1. Female, aged >= 18 years2. A histological diagnosis of operable...for the duration of the study. Minimum ... 18 Years Maximum ... No limit Gender Females Key exclusion criteria...Approval Brief summaryEligibility Key inclusion criteria Minimum ... Maximum ... Gender Key exclusion criteriaContact details and further...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 241 ]
BIOVIA - Scientific Enterprise Software for Chemical Research, Material Science R&D
Updated:
(Feb 20, 2009)
Rate Avg:
(
no ratings
)
(
no ratings
)
...1Slide 2Slide 3Slide 4Slide 5Science in the ... of ExperienceMAY 15-18, 2017 | CHICAGO, ILLEARN...-18 BIOVIA User Forum Science in the ... of Experience June 5 -8 BIOVIA User...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Identification and selection of "privileged fragments" suitable for primary screening.
(Nov, 2008)
Identification and selection of "privileged fragments" suitable for primary screening.
(Nov, 2008)
[ 242 ]
WebCite query result
Updated:
(Jan 10, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Mental wellbeing Participants - inclusion criteria 1. Adults aged 18 or over 2. Located in England 3. Able to read and write English 4. Have access to the internet in order to use the intervention 5. Have an email address where they can be contacted 6. Give informed consent Participants - exclusion criteria 1. Aged under 18 2. Located outside England 3....
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 243 ]
ProteomeXchange Dataset
Updated:
(Feb 14, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...eight proteins that have been associated with ...-related macular degeneration were identified in the...Project curator keyword: Biomedical, Biological submitter keyword: ...-related macular degeneration / Eye / Human / Retina / Phototransduction...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 244 ]
Find out your risk of melanoma - The Victorian Melanoma Clinic
Updated:
(May 24, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...and 1 in 22 for females (to ... 85). Using this calculator, you can calculate...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 245 ]
Secsass – Index
Updated:
(Oct 21, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...1002/prot.340230412 2013 by Jan Zacharias, AG Knapp...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Geometry motivated alternative view on local protein backbone structures.
(Nov, 2013)
Geometry motivated alternative view on local protein backbone structures.
(Nov, 2013)
[ 246 ]
CORUM
Updated:
(Dec 22, 2009)
Rate Avg:
(
no ratings
)
(
no ratings
)
...users may contact the distributor Biomax Informatics AG. © Image credit - http://www.topsan.org...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
CORUM: the comprehensive resource of mammalian protein complexes--2009.
(Jan, 2010)
CORUM: the comprehensive resource of mammalian protein complexes.
(Jan, 2008)
CORUM: the comprehensive resource of mammalian protein complexes--2009.
(Jan, 2010)
CORUM: the comprehensive resource of mammalian protein complexes.
(Jan, 2008)
[ 247 ]
Jack Vanden Heuvel Lab — Penn State University
Updated:
(Aug 10, 2007)
Rate Avg:
(
no ratings
)
(
no ratings
)
...NavigationHomeMajors & MinorsStudent ResourcesGraduate ProgramsYouth ProgramsAlumniResearchExtension Penn State » Ag Sciences » VBS » Research » Faculty Labs » Jack Vanden...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 248 ]
Cool Food Planet – Cool Food Planet
Updated:
(Mar 8, 2004)
Rate Avg:
(
no ratings
)
(
no ratings
)
...or immediately enter space by selecting your ... below…French version: Version françaiseGreek version...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 249 ]
WebCite query result
Updated:
(Nov 21, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...as of 29/04/2008: All participants aged 18 or over and scoring 5 or more on the AUDIT-C screening test. Previous inclusion criteria: All registrants of the How's Your Drink (HYD) website (aged 16 or over) with a functional assessment...participants who are under 18 years of ... 2. Inability to provide informed consent due...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Impact of length or relevance of questionnaires on attrition in online trials: randomized controlled trial.
(Nov 18, 2011)
Impact of length or relevance of questionnaires on attrition in online trials: randomized controlled trial.
(Nov 18, 2011)
[ 250 ]
Journal:JBSD:28 - Proteopedia, life in 3D
Updated:
(Oct 9, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...potential target protein for diseases associated with aging. The structure of Sirt1 protein for virtual...be lead compounds for diseases associated with aging. â Chen KC, Jian YR, Sun...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 251 ]
mody-probability-calculator
Updated:
(Apr 24, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...in patients diagnosed with diabetes under the ... of 35 and was developed on a European Caucasian cohort. Enter the clinical features of the patient in the form below and press the "Calculate Probability" button. ... at diagnosis (years)Sex Male Female Currently...HbA1c (%) or mmol/mol Current ... (yrs)Parent affected with diabetes? Yes No...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 252 ]
Minamata Convention on Mercury > Home
Updated:
(Jul 23, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...new study reveals that women of childbearing ... living in four Pacific Island countries have...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 253 ]
AG Knapp
Updated:
(Feb 25, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...page=PeptideClassifier text/html; charset=utf-8 AG Knapp Warning: file(guest/content/PeptideClassifier.html...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Exploring classification strategies with the CoEPrA 2006 contest.
(Mar 1, 2010)
Exploring classification strategies with the CoEPrA 2006 contest.
(Mar 1, 2010)
[ 254 ]
Ginseng transcriptome
Updated:
(Nov 7, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...level , enhanced liver function, anti-stress, anti-aging improved climacteric disorder and sexual functions. Despite...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Transcriptome profiling and comparative analysis of Panax ginseng adventitious roots.
(Oct 15, 2014)
Transcriptome profiling and comparative analysis of Panax ginseng adventitious roots.
(Oct 15, 2014)
[ 255 ]
ISRCTN32464251
Updated:
(Apr 19, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...abandonedEligibilityParticipant inclusion criteria Elective adult patients (lower ... limit 18 years, no upper ... limit) undergoing operative procedures lasting longer than 45 minutes requiring tracheal intubation muscle relaxation and the insertion of an arterial catheter on clinical grounds who will postoperatively be admitted to the post anaesthetic care unit. Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 256 ]
WebCite query result
Updated:
(Jul 30, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...that reduction in dietary advance glycation endproducts (...) intake will increase insulin sensitivity and normalise insulin secretion in overweight and obese individuals through reduction of chronic low grade inflammation.We propose to test this hypothesis by performing euglycemic hypeinsulinemic glucose clamp and intravenous glucose tolerance test before and after low ... diet and normal Australian diet in a...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 257 ]
Mammography Naive Bayes Classification
Updated:
(May 5, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...irregular margin circumscribedmicrolobulatedobscuredill-definedspiculated density hypodenseisodensehyperdensefat-containing ... younger than 5050 - 64older than 64 BI...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 258 ]
WebCite query result
Updated:
(Aug 6, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
... Key inclusion & exclusion criteria Inclusion criteria: ..., mild to moderate symptoms of depression (BDI), access to InternetExclusion criteria: suicidal ideation, alcoholism, drug abuse, psychosis, current Cognitive Behaviour Therapy (CBT) treatment, individuals who during the last month have begun using or changed dosage of antidepressants ... minimum: 18 Years ... maximum: 65 Years Gender: Both males and...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 259 ]
Antigen Antibody Interaction Database VirGen
Updated:
(Jul 22, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...interactions, AgAbDb also archives information pertaining to Ag and Ab description, definition of Complementarity Determining...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 260 ]
RNA Query | PLATELETOMICS
Updated:
(Apr 18, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Human platelet microRNA-mRNA networks associated with ... and gender revealed by integrated plateletomics. Simon...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 261 ]
WebCite query result
Updated:
(Jul 28, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...to be given, at 9 months of ..., mothers will receive the intervention message depending on their assigned randomization group. When the measles vaccine is administered, the child will be registered as having received the measles vaccination.A follow-up phone interview will be conducted at 12 months of ... for all children participating regardless of randomization...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 262 ]
ICL - EEG - Faculty of Medicine and Life Sciences
Updated:
(Jul 22, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...small sponge, inside which there is an Ag/AgCl electrode. The Geodesic Sensor Net has...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 263 ]
Get In Touch
Updated:
(Oct 17, 2000)
Rate Avg:
(
no ratings
)
(
no ratings
)
...different. It would take into account your ..., your home, its locality, your health condition...release deal. The two major factors are: ... - Companies usually offer the best deals to individuals who are in the latter stages of their life. So, while the normal ... for equity release eligibility is 55, equity...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 264 ]
Maize Genetics COOP Stock Center's Home Page
Updated:
(Mar 1, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...time staffMarty Sachs, DirectorPhilip Stinard, CuratorShane Zimmerman, Ag. Res. Tech.Josh Tolbert, IT SpecialistSeasonal or...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 265 ]
Company Website
Updated:
(Mar 11, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...on TwitterFollow Eppendorf on Youtube© 2017 Eppendorf AG. All rights reserved.ImprintLegal NoticeTrademarks & Patents沪ICPå¤...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 266 ]
FRANz: Pedigree Reconstruction
Updated:
(Aug 11, 2009)
Rate Avg:
(
no ratings
)
(
no ratings
)
...by MCMCIncorporation of prior knowledge (sub-pedigrees, ..., sex, sampling locations, siblings)Simulated Annealing to...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 267 ]
WebCite query result
Updated:
(Sep 2, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...as of 29/04/2008: All participants aged 18 or over and scoring 5 or more on the AUDIT-C screening test. Previous inclusion criteria: All registrants of the How's Your Drink (HYD) website (aged 16 or over) with a functional assessment...participants who are under 18 years of ... 2. Inability to provide informed consent due...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Attrition revisited: adherence and retention in a web-based alcohol trial.
(Aug 30, 2013)
Attrition revisited: adherence and retention in a web-based alcohol trial.
(Aug 30, 2013)
[ 268 ]
SPP Web
Updated:
(Dec 3, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...661 nonwords. In addition, participant characteristics include ..., education, vision, gender, vocabulary, reading comprehension, circadian...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 269 ]
www.adultwork.com
Updated:
(Jan 16, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...consenting that:You are of legal adult ..., as defined by the country or state...to being at least 18 years of ....Terms of Use 2/11/2016 | Privacy...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 270 ]
ESP – Electronic medical record Support for Public health
Updated:
(Dec 16, 2008)
Rate Avg:
(
no ratings
)
(
no ratings
)
...patients with detailed data on patient demographics (..., sex, race/ethnicity, location), important clinical traits...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 271 ]
Intracerebral haemorrhage trial simulator
Updated:
(Sep 24, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Healthboard region of Scotland (mid-2010 population aged 16 years or over was 695,335) who were aged 16 years or over at the time...proportion. The incidence (per 100,000 adults aged 16 years or over per year) is...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 272 ]
WebCite query result
Updated:
(Jul 27, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...free days), and adherence factors of children aged 4-12. The investigators have expanded the...and (2) improve asthma control in children, ... 4-12, with moderate to severe asthma...Volunteers: NoCriteriaInclusion Criteria:Parents of children, aged 4-12 with moderate to severe asthma...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 273 ]
ChromDB::Chromatin Database
Updated:
(Jan 15, 2008)
Rate Avg:
(
no ratings
)
(
no ratings
)
...we work to solve problems with an aging server. If you experience problems, please contact Emerita Professor Carolyn Napoli (cnapoli@ag.arizona.edu), and she will try to...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 274 ]
repRNA
Updated:
(Jan 28, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...of RNA sequences generated in the postgenomic ..., it is highly desired to develop a...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 275 ]
Air Management Practices Assessment Tool - Iowa State University
Updated:
(May 9, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...State UniversitySkip NavigationmenusearchSign-onsISUISU Extension & OutreachCollege of Ag & Life SciencesDept. of Ag & Biosystems EngineeringDirectoryContact UsIndexABCDEFGHIJKLMNOPQRSTUVWXYZ Air Management Practices Assessment...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 276 ]
RSNA TFS
Updated:
(Apr 8, 2004)
Rate Avg:
(
no ratings
)
(
no ratings
)
...OriginalReversibleNon-reversibleModality:Anatomy:Pathology:Name:ID:MRN:... (min [-max]):Years; Months; Weeks; Days Sex
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 277 ]
trial data
Updated:
(Nov 8, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...until the child is 2 years of .... The frequency is about 2 visits each...files of primary health care. At the ... of 6 months, we measure development, anxiety and mother-child interactions. At the ages of 1 and 2 years the home situation will be observed according to safety, availability of food and fruit and of toys. At the ... of 2 other determinants are: child abuse...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 278 ]
ISRCTN - ISRCTN55651027: Sexunzipped pilot online trial
Updated:
(Dec 16, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Reason abandonedEligibilityParticipant inclusion criteria 1. Young people aged 16 - 20 years, either sex2. Living in the UK3. Able to read English Participant type Patient ... group Adult Gender Both Target number of participants 2000 Participant exclusion criteria People aged under 16 or over 21 Recruitment start...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 279 ]
WebCite query result
Updated:
(Oct 25, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...legal guardians of children in each target ... groups will be recruited randomly for the...will be 13 developmental milestones in each ... range. The guardian of each subject check...meets developmental milestones for his/her developmental ..., both the text-based and the multimedia version. A total score will be calculated and compared. Other: text-based or multimedia subjects fills in a questionnaire regarding whether the child meets the developmental milestones for his/her developmental .... EligibilityAges Eligible for Study: 20...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 280 ]
www.pharmacogenetics.ca
Updated:
(Sep 21, 2004)
Rate Avg:
(
no ratings
)
(
no ratings
)
...an opportunity to leave behind the dark ages of prescribing by trial and error, and...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 281 ]
monkey.html
Updated:
(Feb 23, 2009)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Health and Science University National Institutes of Aging November 13, 2008DescriptionOne of the most critical...joint collaboration between the National Institute on Aging, Oregon Health and Science University and University...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
A population-average MRI-based atlas collection of the rhesus macaque.
(Mar 1, 2009)
A population-average MRI-based atlas collection of the rhesus macaque.
(Mar 1, 2009)
[ 282 ]
Atomic Scattering Factors
Updated:
(May 4, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Zr* Nb Mo* Tc Ru* Rh Pd Ag Cd In Sn Sb Te I Xe...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 283 ]
NOMOGRAMS FOR PREDICTING SURVIVAL OF GBM PATIENTS
Updated:
(Jan 7, 2008)
Rate Avg:
(
no ratings
)
(
no ratings
)
...based on 7different prognostic factors: Therapy administered, ..., Extent of surgery, Mini Mental Score Examination...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 284 ]
DDRprot:DDR Proteins Data Base
Updated:
(Aug 31, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
... Xenopus tropicalis [Vertebrata] Evolutionary ...:Select ... Bilateria Chordata Early Eukaryote Metazoa Opisthokonta Prokaryotes Unikonta Vertebrata Viridiplantae PTMs:Select ...AcetylationPhosphorylationSumoylationUbiquitinationSearch by fasta sequence* Paste an example sequencehumanDDR Orthdb Network view panel zoom or drag aroundColour by: PathwayGene ...◉Prokaryotes◉Early Eukaryote◉Viridiplantae◉Unikonta◉Opisthokonta◉Metazoa...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 285 ]
DIANA TOOLS - microT v4
Updated:
(Jun 30, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Gousis, K. Kourtis, N. Koziris, T. Dalamagas, AG. Hatzigeorgiou DIANA-microT Web server upgrade supports...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 286 ]
References
Updated:
(Sep 13, 2006)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Microbiol. (2006) 53: 315. Adl SM, Simpson AG, Farmer MA, Andersen RA, Anderson OR, Barta...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 287 ]
PROF_PAT homepage
Updated:
(Oct 20, 2000)
Rate Avg:
(
no ratings
)
(
no ratings
)
...pub/databases/prof_pat/Please cite:Bachinsky A.G., et al. PROF_PAT 1.3: Updated...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
PROF_ PAT 1.3: updated database of patterns used to detect local similarities.
(Apr, 2000)
PROF_ PAT 1.3: updated database of patterns used to detect local similarities.
(Apr, 2000)
[ 288 ]
Head Templates and Atlas: | Institute for Learning and Brain Sciences (I-LABS)
Updated:
(Sep 26, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Dager SR, Wroblewski L, et al. (2013) ...-Specific Average Head Template for Typically Developing...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Age-specific average head template for typically developing 6-month-old infants.
(2013)
Age-specific average head template for typically developing 6-month-old infants.
(2013)
[ 289 ]
Homepage - The University of Queensland, Australia
Updated:
(May 7, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Open Day11 May Clem Jones Centre for Ageing Dementia Research Public Dementia Forum12 May Prestigious...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 290 ]
1471-2105-7-152-S3
Updated:
(Apr 14, 2006)
Rate Avg:
(
no ratings
)
(
no ratings
)
...TL TB CR BA PT LA CE AG AU GA LU IDO U1 EU BRO...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 291 ]
Eldercare Locator
Updated:
(Aug 31, 2007)
Rate Avg:
(
no ratings
)
(
no ratings
)
...public service of the U.S. Administration on Aging connecting you to services for older adults...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 292 ]
Bagel automated bacteriocin mining
Updated:
(Jun 24, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Genetics University of Groningen Nijenborgh 7 9747 AG Groningen the NetherlandsHome Page Molecular geneticsWho's Online...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 293 ]
SpliceDB: canonical and non-canonical splice site sequences in mammalian genes
Updated:
(Jan 4, 2001)
Rate Avg:
(
no ratings
)
(
no ratings
)
...HTG supported pairsXMammalian frequency matrices for GT-AG pairs donor site 34.08 60.36...10.37 Mammalian frequency matrices for GC-AG pairs donor site 40.48 88.89...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
SpliceDB: database of canonical and non-canonical mammalian splice sites.
(Jan 1, 2001)
SpliceDB: database of canonical and non-canonical mammalian splice sites.
(Jan 1, 2001)
[ 294 ]
Supporting Online Material | Science
Updated:
(Jun 19, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...ProgramsBookletsCareers FeaturesAbout CareersSearchSearch Supporting Online Material Remeasuring Aging Warren C. Sanderson and Sergei Scherbov Supporting...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 295 ]
Case-Control Matching Algorithm - Control Matching - i2b2 Community Wiki
Updated:
(Dec 8, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...controls based on data points in common (..., gender, race, number of healthcare encounters, etc...For example, if the user requests patient ... binned into 8 quantiles, three bin results...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 296 ]
AML Score: Home
Updated:
(May 19, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...therapy in patients of 60 years of ... or older with previously untreated AML. The...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 297 ]
"I Wanted You To Know" - Home
Updated:
(Sep 29, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...most common form of cancer among women aged 20 to 59. It is the cancer...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
I wanted you to know: Breast cancer survivors' control of workplace communication about cancer.
(Oct, 2015)
I wanted you to know: Breast cancer survivors' control of workplace communication about cancer.
(Oct, 2015)
[ 298 ]
View | Maps & Data | Home - ChiMat Data Atlas
Updated:
(Mar 25, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Mortality and Stillbirths ProfilesBreastfeeding ProfilesEarly Years ProfilesSchool-... Children ProfilesYoung People's ProfilesOther Health ProfilesService Planning...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 299 ]
Bioliteracy Project Home Page
Updated:
(Jun 3, 2008)
Rate Avg:
(
no ratings
)
(
no ratings
)
...kind, is Reason. Thomas Paine, 1794. The ... of Reason. ← the BCI link to...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 300 ]
WebCite query result
Updated:
(Sep 29, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...of drugs, radiation sites and doses, and ... at time of treatment on: 1. Ovarian...a central nervous system tumour before the ... of 18; 3. Treated between 1965 and...may enter menopause as early as the ... of 32. With the current Dutch trend...of drugs, radiation sites and doses, and ... at time of treatment on: 1. Ovarian...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 301 ]
15563650.2015.1112014
Updated:
(Mar 4, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...characteristics of acute poisoning in several pediatric ... groups. Methods: This retrospective study involved acutely poisoned patients, 0â18 years of ..., who presented to the ASU-PTC between...52%) were younger than 6 years of ...; 4196 (11%) were 6â12 years...were with self-harm intent. In all ... groups, the most frequent causative drugs were...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 302 ]
Max Schelker
Updated:
(Sep 10, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...2011"Systems approaches to kidney degeneration and ...-related kidney disease" in cooperation with the Kidney Research Center Cologne @ZBSA-Evaluation 03/2011"Dealing with input signals in systems biology models" @Spring School Seeon 201102/2011"Dealing with input signals in systems biology models" @FEBS-SystemsX-SysBio201102/2011"Systems approaches to kidney degeneration and ...-related kidney disease" in cooperation with the...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Comprehensive estimation of input signals and dynamics in biochemical reaction networks.
(Sep 15, 2012)
Comprehensive estimation of input signals and dynamics in biochemical reaction networks.
(Sep 15, 2012)
[ 303 ]
ProteomeXchange Dataset
Updated:
(Feb 11, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...C57BL/6 mice, at 10 weeks of ..., were injected daily intraperitoneally with 0.5...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 304 ]
Snipper app suite version 2.5
Updated:
(Aug 28, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...several papers.A new tool to predict ... is available.Inner calculations are now done...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 305 ]
Katherine Pollard's Research Group -- Gladstone Institutes, UCSF
Updated:
(Feb 19, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...selection with p-values ProteinHistorian: Eukaryotic protein ... estimation and enrichment analysisStatistical ProgrammingR and Bioconductor...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
G-NEST: a gene neighborhood scoring tool to identify co-conserved, co-expressed genes.
(Sep 28, 2012)
G-NEST: a gene neighborhood scoring tool to identify co-conserved, co-expressed genes.
(Sep 28, 2012)
[ 306 ]
CAP PC NY | Child and Adolescent Psychiatry for Primary Care
Updated:
(Aug 6, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...assess and manage children and adolescents (to ... 21) in their practices with mild to...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Teaching child psychiatric assessment skills: Using pediatric mental health screening tools.
(2015)
Teaching child psychiatric assessment skills: Using pediatric mental health screening tools.
(2015)
[ 307 ]
s00103-012-1521-4
Updated:
(Jan 30, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Springer Nature © 2017 Springer International Publishing AG. Part of Springer Nature.Not logged in...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 308 ]
Lymphedema Risk Calculator - Risk of Arm Lymphedema Calculator
Updated:
(Jul 25, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...To Main Site Calculator: Patients ...*Patients weight (Kg) *Patients height (meter)*Number...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Nomograms for predicting the risk of arm lymphedema after axillary dissection in breast cancer.
(Aug, 2012)
Nomograms for predicting the risk of arm lymphedema after axillary dissection in breast cancer.
(Aug, 2012)
[ 309 ]
FoRSA – Fold Recognition using a Structural Alphabet
Updated:
(Dec 30, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...amino acid sequences. Mahajan S, de Brevern AG, Sanejouand YH, Srinivasan N, Offmann B.Protein...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 310 ]
PhylOPDb
Updated:
(Apr 28, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...NatranaerobiusNatronovirgaAmmonifexCaldanaerobacterCaldanaerobiusDesulfovirgulaGelriaMahellaMoorellaSporotomaculumTepidanaerobacterThermacetogeniumThermanaeromonasThermoanaerobacterCoprothermobacterThermodesulfobiumCaldanaerovirgaCaldicellulosiruptorSyntrophaceticusThermoanaerobacteriumThermosediminibacterThermovenabulumThermovoraxDesulfitibacterAllobaculumBulleidiaCatenibacteriumCoprobacillusErysipelothrixHoldemaniaSharpeaSolobacteriumTuricibacterThermolithobacterCetobacteriumFusobacteriumIlyobacterJ2-29PropionigeniumU114LeptotrichiaSebaldellaSneathiaStreptobacillusPsychrilyobacterGemmatimonasLentisphaeraVictivallisCANDIDATUS_METHYLOMIRABILISLeptospirillumNitrospiraThermodesulfovibrio4-29GOUTA7CANDIDATUS_MAGNETOBACTERIUMJG37-AG-70BD2-6DCE29GOUTA19HB118LCP-6CANDIDATUS_SCALINDUAPhycisphaeraA17BlastopirellulaCANDIDATUS...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 311 ]
myPEG User Interface :: E-GWAS
Updated:
(Oct 21, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Alhathli, J. Dudley, M.D. Sanderford, L.B. Scheinfeldt A.G. Chaudhary, M.H. Al-Qahtani, S. Kumar E...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 312 ]
Calit2 : California Institute for Telecommunications and Information Technology
Updated:
(Aug 12, 2004)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Diego 92101 May. 3, 2017Cryptography in the ... of Mass SurveillanceGuest Speaker: Mihir Bellare, UC...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Haplotype reconstruction from genotype data using Imperfect Phylogeny.
(Aug 12, 2004)
Haplotype reconstruction from genotype data using Imperfect Phylogeny.
(Aug 12, 2004)
[ 313 ]
SAVE score for VA ECMO
Updated:
(Sep 2, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...lung transplantation Congenital heart disease Other diagnoses ... (years):18-38 39-52 53-62...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 314 ]
TassDB - TAndem Splice Site DataBase
Updated:
(May 31, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...GYN donors and NAG(N)0-10AG acceptors in human and mouse, where the...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
TassDB2 - A comprehensive database of subtle alternative splicing events.
(2010)
TassDB2 - A comprehensive database of subtle alternative splicing events.
(2010)
[ 315 ]
WebCite query result
Updated:
(Feb 23, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...â Focus Groups:⢠Aged between 14 and 21 years old.â...¢ Patients over 16 years of ... with a new diagnosis of JIA (diagnosis within 6 months).Parent â Dissemination of web-address:⢠Parent of patients under 16 years of ... with a new diagnosis of JIA (diagnosis...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 316 ]
SAMSON - Homepage
Updated:
(Aug 3, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
... © SAMSON AG ImpressumDatenschutzAllgemeine...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 317 ]
ProteomeXchange Dataset
Updated:
(Jul 21, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...and SIRT7: Implication of functional links to aging. Proteomics, 14(13-14):1610-22(2014...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 318 ]
Willi will wachsen
Updated:
(Aug 29, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...does not contain data throughout the whole ... range from birth to maturity, or does...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 319 ]
DBDiaSNP: A Comprehensive Repository of Variations among Diarrheal Pathogens DBDiaSNP
Updated:
(Sep 29, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...mortality among children under 5 years of ... and is associated with impaired physical and...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 320 ]
www.catsys.dk
Updated:
(Apr 7, 2009)
Rate Avg:
(
no ratings
)
(
no ratings
)
...and coordination ability. A comprehensive gender-and-... separated normal material has been published by...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Objective tremor registration during DBS surgery for essential tremor.
(May, 2009)
Objective tremor registration during DBS surgery for essential tremor.
(May, 2009)
[ 321 ]
The Kango Net
Updated:
(Jul 13, 2009)
Rate Avg:
(
no ratings
)
(
no ratings
)
...supporting patients with cancer and/or advanced ... who have to continue treatment at home...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 322 ]
The JMML Foundation - HOME
Updated:
(Jan 27, 2009)
Rate Avg:
(
no ratings
)
(
no ratings
)
...which affects young children, generally under the ... of five. The JMML Foundation exists to...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Juvenile myelomonocytic leukemia: a report from the 2nd International JMML Symposium.
(Mar, 2009)
Juvenile myelomonocytic leukemia: a report from the 2nd International JMML Symposium.
(Mar, 2009)
[ 323 ]
Imagin Eyes | Adaptive optics, adapted to eye care
Updated:
(Jun 21, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...al. , AJO Ultrahigh-resolution retinal imagingEffects of ..., blood pressure and antihypertensive treatments on retinal...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Eccentricity dependent changes of density, spacing and packing arrangement of parafoveal cones.
(Jul, 2013)
Eccentricity dependent changes of density, spacing and packing arrangement of parafoveal cones.
(Jul, 2013)
[ 324 ]
www.pedsanesthesia.org
Updated:
(Jun 9, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...in children younger than three years of ... or in pregnant women during the final...more information.Neurodevelopmental outcomeat 2 years of ... after general anaesthesia and awake-regional anaesthesia...of neurodevelopmental outcome at 2 years of ... in the General Anaesthesia compared to Spinal...anesthesiologists take care of children of all ages from newborn to teenagers and are experienced in the special needs of children (and their families) at different ages. Their goal is to make the hospital...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 325 ]
NED
Updated:
(Feb 20, 2009)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Surgery Registry- Retinoblastoma Registry- Diabetic Eye Registry- ... Related Macular Degeneration (AMD)Performance Monitoring- Key...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 326 ]
USEARCH
Updated:
(Sep 24, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Cornell Univ. CNRS (France) La Jolla Institute Ag. Research (NZ) Broad Institute Nestle LANL UC...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 327 ]
ICTRP Search Portal
Updated:
(Sep 7, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Hong KongKey inclusion & exclusion criteriaInclusion criteria: Patients aged 18-70 and fulfilling the Katz CTS...serious illnesses will be considered as ineligible. ... minimum: 18 ... maximum: 70 Gender: BothHealth Condition(s) or...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 328 ]
King's College London - Home
Updated:
(Jun 22, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Adolescent PsychiatryForensic & Neurodevelopment ScienceHealth Service & Population ResearchNeuroimagingOld ... PsychiatryPsychological MedicinePsychologyPsychosis StudiesSocial, Genetic & Development Psychiatry Centre (MRC)MRC Centre for Developmental NeurobiologyWolfson Centre for ... Related Diseases (CARD)The Dickson Poon School...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
The molecular basis of haemophilia B.
(Jul, 1998)
Haemophilia B: database of point mutations and short additions and deletions--eighth edition.
(Jan 1, 1998)
The molecular basis of haemophilia B.
(Jul, 1998)
Haemophilia B: database of point mutations and short additions and deletions--eighth edition.
(Jan 1, 1998)
[ 329 ]
Home - Springer
Updated:
(Sep 9, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...comSpringerProtocolsSpringerMaterialsAdisInsightHelp & ContactsContact UsImpressumLegal © Springer International Publishing AG. Part of Springer Nature. Privacy Policy, Disclaimer...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 330 ]
www.malawi.pop.upenn.edu
Updated:
(Jun 18, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Pennsylvania population studies center sitesPopulation Studies CenterPopulation Aging Research CenterGraduate Group in DemographyStatus of Women...of Antiretroviral TreatmentNewsletter 2016-1: Mature Adults & Aging ResearchMLSFH Cohort Profile (Int. J. of Epidemiology...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Cohort Profile: The Malawi Longitudinal Study of Families and Health (MLSFH).
(Apr, 2015)
Cohort Profile: The Malawi Longitudinal Study of Families and Health (MLSFH).
(Apr, 2015)
[ 331 ]
PAM Score
Updated:
(Oct 10, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...the drop down menus. PAM CalculatorAge Patient ......
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Predicting mortality and cost of hematopoeitic stem-cell transplantation.
(Jan, 2012)
Predicting mortality and cost of hematopoeitic stem-cell transplantation.
(Jan, 2012)
[ 332 ]
Scoliosis Resource Centre for Teens - AboutKidsHealth
Updated:
(Oct 7, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Months)Preschoolers (2 to 4 Years)School-... Children (5 to 8 Years)Tweens (9...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 333 ]
Early Nutrition Academy: Home
Updated:
(Nov 22, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...relates to nutrition in women of childbearing ..., infants and children, including basic science, epidemiology...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
The Early Nutrition Programming Project (EARNEST): 5 y of successful multidisciplinary collaborative research.
(Dec, 2011)
The Early Nutrition Programming Project (EARNEST): 5 y of successful multidisciplinary collaborative research.
(Dec, 2011)
[ 334 ]
Brace Treatment Outcome Prediction
Updated:
(Oct 17, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...accuracy is 73-75%. The patients were aged 13.5 ± 1.7 years (range...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 335 ]
SIMAP
Updated:
(Jan 15, 2008)
Rate Avg:
(
no ratings
)
(
no ratings
)
...users may contact the distributor Biomax Informatics AG...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 336 ]
Software - Wake Forest School of Medicine
Updated:
(Jun 26, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...basis of race, color, national origin, sex, ... or disability. Learn more about our nondiscrimination...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
FusionQ: a novel approach for gene fusion detection and quantification from paired-end RNA-Seq.
(Jun 15, 2013)
FusionQ: a novel approach for gene fusion detection and quantification from paired-end RNA-Seq.
(Jun 15, 2013)
[ 337 ]
ICTRP Search Portal
Updated:
(Mar 4, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Exclusion criteria: absence of the respective diagnosis ... minimum: 18 Years ... maximum: no maximum ... Gender: Both, male and femaleHealth Condition(s...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 338 ]
searchresult.php?id=14522&number=1
Updated:
(Mar 11, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Inclusion criteria are type two diabetic patients aged between 20-70 who live in the...type two at least for one year; aged between 20-70 years; be able to...ongoing experimental research; pregnancy and lactation Minimum ... : Year: 20 Maximum ... : Year: 70 ...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 339 ]
King's College London - Alzheimer's Disease research
Updated:
(May 25, 2009)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Adolescent PsychiatryForensic & Neurodevelopment ScienceHealth Service & Population ResearchNeuroimagingOld ... PsychiatryPsychological MedicinePsychologyPsychosis StudiesSocial, Genetic & Development Psychiatry Centre (MRC)MRC Centre for Developmental NeurobiologyWolfson Centre for ... Related Diseases (CARD)The Dickson Poon School...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Meta-analysis of linkage studies for Alzheimer's disease--a web resource.
(Jul, 2009)
Meta-analysis of linkage studies for Alzheimer's disease--a web resource.
(Jul, 2009)
[ 340 ]
Lung Cancer Risk Form
Updated:
(Aug 31, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...individuals between 35 and 75 years of ... who are currently lung cancer-free. All...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
A prognostic tool to identify adolescents at high risk of becoming daily smokers.
(2011)
A prognostic tool to identify adolescents at high risk of becoming daily smokers.
(2011)
[ 341 ]
WHO | Neurology and public health
Updated:
(Jul 31, 2006)
Rate Avg:
(
no ratings
)
(
no ratings
)
...the extension of life expectancy and the ageing of the general populations in both developed...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
WHO/WFN Survey of neurological services: a worldwide perspective.
(Aug 15, 2006)
WHO/WFN Survey of neurological services: a worldwide perspective.
(Aug 15, 2006)
[ 342 ]
PolyprOnlinE
Updated:
(Nov 8, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...cite: Chebrek R, Leonard S, de Brevern AG, Gelly J-C (2014) PolyprOnline: polyproline helix...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 343 ]
Supporting website for SMARTS: Reconstructing disease response networks from multiple individuals
Updated:
(Apr 12, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...in their background expression profiles due to ..., genetics and life factors. In addition, there...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 344 ]
Bioconductor - GOSemSim
Updated:
(Mar 26, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...PathwaysDependsAnnotationDbi, GO.db, org.Hs.eg.dbImportsSuggestsorg.Ag.eg.db, org.At.tair.db, org...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
GOSemSim: an R package for measuring semantic similarity among GO terms and gene products.
(Apr 1, 2010)
GOSemSim: an R package for measuring semantic similarity among GO terms and gene products.
(Apr 1, 2010)
[ 345 ]
PHIDIAS Rechtsanwälte
Updated:
(Sep 30, 2004)
Rate Avg:
(
no ratings
)
(
no ratings
)
...ischer Geltung besteht über die ERGO Versicherung AG (ehemals Victoria), Victoriaplatz 2, 40198 Düsseldorf. Â...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 346 ]
Delft Bio-Informatics Lab
Updated:
(Oct 21, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...underlying genetic diseases such as cancer and aging; and in biotechnology, engineering industrially relevant microorganisms...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Exploring Sequence Characteristics Related to High-Level Production of Secreted Proteins in Aspergillus niger.
(2012)
Integrating genome assemblies with MAIA.
(Sep 15, 2010)
Inferring combinatorial association logic networks in multimodal genome-wide screens.
(Jun 15, 2010)
Delineation of amplification, hybridization and location effects in microarray data yields better-quality normalization.
(2010)
Exploring Sequence Characteristics Related to High-Level Production of Secreted Proteins in Aspergillus niger.
(2012)
Integrating genome assemblies with MAIA.
(Sep 15, 2010)
Inferring combinatorial association logic networks in multimodal genome-wide screens.
(Jun 15, 2010)
Delineation of amplification, hybridization and location effects in microarray data yields better-quality normalization.
(2010)
[ 347 ]
registry
Updated:
(Jun 19, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...-76.5) yrs.Mutations Identified Number of cases ... at Diagnosis13.1 (0-58.18) yrs.KCNJ1181Gender–...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 348 ]
Links to useful software - Institute of Basic Medical Sciences
Updated:
(Jan 26, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Research centresResearch networksBMMSSERTA: Genome IntegritySERTA: Healthy Brain Ageing CentreAbout the researchAreas of priorityThematic AreasResearch infrastructurePublicationsBooksClinico...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Survival prediction from clinico-genomic models--a comparative study.
(2009)
Predicting survival from microarray data--a comparative study.
(Aug 15, 2007)
Survival prediction from clinico-genomic models--a comparative study.
(2009)
Predicting survival from microarray data--a comparative study.
(Aug 15, 2007)
[ 349 ]
ABIRISK
Updated:
(Aug 14, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...to announce that Sebastian Spindeldreher, Novartis Pharma AG, is taking over the project coordinator role...¬34.9 millionProject coordinator: Novartis Pharma AG (Sebastian Spindeldreher)Managing entity: INSERM (Marc Pallardy...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 350 ]
ISRCTN - ISRCTN95538913: Web-based screening and brief Intervention for substance using teens
Updated:
(May 25, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...recruiting Plain English SummaryBackground and study aimsAdolescents aged 16 to 18 are at risk of...and abstaining from illegal drugs among adolescents aged 16 to 18 in Belgium, Germany, Czech Republic and Sweden. Who can participate? Adolescents aged 16 to 18 from Sweden, Czech Republic...gov numberProtocol/serial number JUST/2010/DPIP/AG/0914-30-CE-0379823/00-48 Study...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 351 ]
aTLC
Updated:
(Feb 2, 2007)
Rate Avg:
(
no ratings
)
(
no ratings
)
...of Principles and Actions. These documents synthesize ...-old wisdom and leading scientific research supporting...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Selected researched evidence supporting the work of launching families.
(Oct, 2001)
Selected researched evidence supporting the work of launching families.
(Oct, 2001)
[ 352 ]
AlzBase
Updated:
(Jan 7, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...AD).1) Gene dys-regulation in AD, aging and related diseases. 2) Multi-level annotations...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
AlzBase: an Integrative Database for Gene Dysregulation in Alzheimer's Disease.
(Jan, 2016)
AlzBase: an Integrative Database for Gene Dysregulation in Alzheimer's Disease.
(Jan, 2016)
[ 353 ]
Home Português - CTS
Updated:
(Jun 27, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Linguagem Aprendizagem Fisioterapia/Ergonomia Biofeedback Arquitetura/Engenharia Ag. Publicidade e Propag. Promoções Aplicativos...Linguagem Aprendizagem Fisioterapia/Ergonomia Biofeedback Arquitetura/Engenharia Ag. Publicidade e Propag. Promoções Aplicativos (Apps...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
The relationship between tongue trill performance duration and vocal changes in dysphonic women.
(Jul, 2011)
The relationship between tongue trill performance duration and vocal changes in dysphonic women.
(Jul, 2011)
[ 354 ]
ISRCTN77864351
Updated:
(Mar 24, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Students from high schools in the Netherlands, aged between 12 and 30. What does the...smoking behaviour and intention to start smoking. ..., gender and educational level are also assessed...assessed in the Smoke Alert-questionnaire are ..., gender, educational level and level of physical...students from high schools in the Netherlands, aged between 12 and 30. Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 355 ]
King's College London - Institute of Psychiatry, Psychology & Neuroscience
Updated:
(May 24, 2004)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Adolescent PsychiatryForensic & Neurodevelopment ScienceHealth Service & Population ResearchNeuroimagingOld ... PsychiatryPsychological MedicinePsychologyPsychosis StudiesSocial, Genetic & Development Psychiatry Centre (MRC)MRC Centre for Developmental NeurobiologyWolfson Centre for ... Related Diseases (CARD)The Dickson Poon School...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
2LD, GENECOUNTING and HAP: Computer programs for linkage disequilibrium analysis.
(May 22, 2004)
2LD, GENECOUNTING and HAP: Computer programs for linkage disequilibrium analysis.
(May 22, 2004)
[ 356 ]
GlycoForm and Glycologue Home Page
Updated:
(Jul 16, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Bioeng. 92(6), 711-728. [2] McDonald, A.G., Tipton, K.F., Stroop, C.J.M. and Davey, G.P....
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 357 ]
The complexity of NF-κB signaling in inflammation and cancer | Molecular Cancer | Full Text
Updated:
(Nov 15, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...cells, which would otherwise become apoptotic or senescent. This elevated constitutive NF-κB activity is...Pepper C: The Hsp90 inhibitor NVP-AUY922-AG inhibits NF-κB signaling, overcomes microenvironmental cytoprotection...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Cancer risk in immune-mediated inflammatory diseases: IMID and Cancer Risk.
(2013)
Cancer risk in immune-mediated inflammatory diseases: IMID and Cancer Risk.
(2013)
[ 358 ]
TreeComplexity
Updated:
(Jan 28, 2003)
Rate Avg:
(
no ratings
)
(
no ratings
)
... Purine/Pyrimidine [AG][TC] ...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 359 ]
NHS Choices Home Page
Updated:
(Dec 1, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...news reportsMedical practice news reportsOlder people and ageing news reportsGenetics and stem cells news reportsMental...articlesGot a breastfeeding question?What's your heart ...?HaemophiliaSign into Facebook Messenger to talk to...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 360 ]
Home | mFES
Updated:
(Nov 20, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...1002/jcc.24053[article]By Ilkay Sakalli @ AG Knapp 2017Supported by: ...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 361 ]
WebCite query result
Updated:
(Mar 2, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...inactivity, Excessive alcohol intake- Inclusion criteria1. Adults, aged 18-65, male or female; 2. Sufficient understanding of Dutch language; 3. Participation in Health Monitor 2009.- Exclusion criteria1. Aged under 18 or above 65; 2. Insufficient...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 362 ]
Strategic framework – Education & Training 2020 - European Commission
Updated:
(Aug 21, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...and help address common challenges, such as ageing societies, skills deficits in the workforce, technological...education at all levels and for all ... groups.In 2009, ET 2020 set four...of children (from 4 to compulsory school ...) should participate in early childhood educationfewer than 15% of 15-year-olds should be under-skilled in reading, mathematics and sciencethe rate of early leavers from education and training aged 18-24 should be below 10%at least 40% of people aged 30-34 should have completed some form...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 363 ]
Children's Hospital Oakland Research Institute
Updated:
(Jan 26, 2005)
Rate Avg:
(
no ratings
)
(
no ratings
)
...for men, women and children of all ages Pioneered development of a low-cost meningococcal...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 364 ]
ICPSR
Updated:
(Jan 5, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...and Human Development (NICHD) National Institute on Aging (NIA) National Institute on Drug Abuse (NIDA...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 365 ]
Meta-Analysis Global Group in Chronic Heart Failure
Updated:
(May 15, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...risk assessments before this date.Patient Reference ... Gender Diabetes COPD Heart failure diagnosed within...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Predicting survival in heart failure: a risk score based on 39 372 patients from 30 studies.
(May, 2013)
Predicting survival in heart failure: a risk score based on 39 372 patients from 30 studies.
(May, 2013)
[ 366 ]
Neurex | Neuroscience, upper-rhine network
Updated:
(Jun 7, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Strasbourg.Read more…Visit of Novartis Pharma AG Publication date : 2017/04/25This visit will...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 367 ]
20 Nov 2012. Life Sciences Momentum 2012: H. Westerhoff, B. van Ommen, B. Groen
Updated:
(May 17, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...for Systems BiomedicineAuckland Bioengineering InstituteUniversite de GeneveSiemens AG ÃsterreichAlacris Theranostics GmbHCharite Universitätsmedizin...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
IT Future of Medicine: from molecular analysis to clinical diagnosis and improved treatment.
(May 25, 2013)
IT Future of Medicine: from molecular analysis to clinical diagnosis and improved treatment.
(May 25, 2013)
[ 368 ]
WHO | World Health Organization
Updated:
(Mar 4, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...all malaria deaths occurred, and in children aged under 5 years, who accounted for more...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 369 ]
WebCite query result
Updated:
(Mar 4, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Exclusion criteria: absence of the respective diagnosis ... minimum: 18 Years ... maximum: no maximum ... Gender: Both, male and female Health Condition...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 370 ]
ISRCTN - ISRCTN42261314: Insecticide Treated bedNets (ITNs) for malaria control in Urban Accra
Updated:
(Aug 5, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...12/2004 Reason abandonedEligibilityParticipant inclusion criteria Children aged over 1 month and under 10 years Participant type Patient ... group Child Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Cohort trial reveals community impact of insecticide-treated nets on malariometric indices in urban Ghana.
(Jul, 2010)
Cohort trial reveals community impact of insecticide-treated nets on malariometric indices in urban Ghana.
(Jul, 2010)
[ 371 ]
SVM-PB-Pred - Bharathidasan University, India
Updated:
(Jun 30, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...21(8), 736-742 .[2] de Brevern,A.G., Etchebest,C and Hazout,S. (2000) Bayesian...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 372 ]
WebCite query result
Updated:
(Mar 4, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...wanting to quit.Update: Reason:Minimum ...:16 YearsUpdate: Reason:Maximum ...: No limitUpdate: Reason:Gender:Both...dynamic random allocation with stratified minimisation by ..., ethnic group, level of dependenceUpdate: Reason...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 373 ]
Mouse Retina Developmental Gene Expression
Updated:
(Feb 26, 2004)
Rate Avg:
(
no ratings
)
(
no ratings
)
...related properties. "P#" = post-natal day (mouse ... in number of days after birth) Recently...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Global gene expression analysis of the developing postnatal mouse retina.
(Mar, 2004)
Global gene expression analysis of the developing postnatal mouse retina.
(Mar, 2004)
[ 374 ]
WebCite query result
Updated:
(Jun 28, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...the QuitTXT text-message program helps smokers ages 18 29 stop smoking. This is part...how well the QuitTXT program helps smokers ages 18 29 stop smoking.Eligibility:- Adults ages 18 29 who have smoked on at...cessation intervention designed for young adult smokers ages 18-29. The QuitTXT program is a...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 375 ]
WebCite query result
Updated:
(Aug 20, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...tailored advice- Inclusion criteriaDaily smokers, between the ... of 18-65, willing to quit individually...the Netherlands among daily smokers, in the ... of 18-65 years, willing to quit...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 376 ]
Catalogue of Imprinted Genes and Parent-of-origin Effects in Humans and Animals
Updated:
(Mar 2, 2006)
Rate Avg:
(
no ratings
)
(
no ratings
)
...and Jabs EW. Dear Old Dad. Sci Aging Knowl Environ., Vol 2004, issue 3. Abstract...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Analysis of allelic differential expression in human white blood cells.
(Mar, 2006)
Analysis of allelic differential expression in human white blood cells.
(Mar, 2006)
[ 377 ]
WebCite query result
Updated:
(Aug 13, 2009)
Rate Avg:
(
no ratings
)
(
no ratings
)
...inclusion criteria Inactive adolescent boys and girls aged 12-18 years recruited through high schools and inactive young adults aged 25-35 years recruited through companies. Participants...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 378 ]
WebCite query result
Updated:
(Feb 4, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...programs that target young adolescents around the ... of 12 and there have been several interventions at colleges and universities to reduce excessive alcohol use in students. Until now, the ... group 16-18 years was not a...intervention to reduce binge drinking in adolescents aged 16-18 years. A specific goal of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 379 ]
WebCite query result
Updated:
(Apr 22, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...programs that target young adolescents around the ... of 12 and there have been several interventions at colleges and universities to reduce excessive alcohol use in students. Until now, the ... group 16-18 years was not a...intervention to reduce binge drinking in adolescents aged 16-18 years. A specific goal of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 380 ]
ISRCTN76460837
Updated:
(Apr 20, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...about depression designed for middle- to older-aged consumers from a non-English speaking background...studies are representative of middle- to older-aged people of both genders who are Greek...abandonedEligibilityParticipant inclusion criteria 1. Middle- to older-aged (45+ years of ...), either sex2. Greek-born or Italian-born first generation immigrants3. Living in Melbourne, Australia Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 381 ]
Ingenovis Blog - Catatan informasi dan artikel sehari-hari Ingenovis
Updated:
(Jul 16, 2008)
Rate Avg:
(
no ratings
)
(
no ratings
)
...comRead More Jual WARDAH Renew You Anti Aging Day Cream 17ml Harga Rp45,000 March 17, 2017 ingenoviSelamat berjumpa lagi, anda sedang mencari lipstik wardah long lasting di page ini anda bisa memperolehnya. Nama Item : WARDAH Renew You Anti Aging Day Cream 17mlHarga : Rp45,000 Jika kamu...silahkan langsung ke WARDAH Renew You Anti Aging Day Cream 17ml Ralali.comRead More Harga...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 382 ]
Enduring Legacy - Cornell Veterinary Medicine
Updated:
(Aug 2, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Pioneers (1920-1949)Part II: Coming of ... (1950-1974)Part III: The Modern Era...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
150th anniversary of veterinary education and the veterinary profession in North America: part 2, 1940-1970.
(Apr, 2011)
150th anniversary of veterinary education and the veterinary profession in North America: part 2, 1940-1970.
(Apr, 2011)
[ 383 ]
Vet Med Home | UC Davis School of Veterinary Medicine
Updated:
(Apr 15, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...affected by dementia with the aid of aging horses.Complete StoryEnvironmental HealthWastewater Treatment a Health...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Search filters, a new tool in the search for alternatives: locating mouse strains as disease models.
(Jun, 2004)
Search filters, a new tool in the search for alternatives: locating mouse strains as disease models.
(Jun, 2004)
[ 384 ]
High-resolution in vivo atlas' of subcortical structures. • TIGRlab
Updated:
(Jun 3, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...from 5 volunteers (2 male; 3 female; ... range: 29â57, avg. 37) using...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
A novel in vivo atlas of human hippocampal subfields using high-resolution 3T magnetic resonance imaging.
(Jul 1, 2013)
A novel in vivo atlas of human hippocampal subfields using high-resolution 3T magnetic resonance imaging.
(Jul 1, 2013)
[ 385 ]
ISRCTN34326236
Updated:
(Dec 2, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...1. Male and female patients over the ... of 18 years suffering from asthma2. Have...six months before recruitment. Participant type Patient ... group Adult Gender Both Target number of participants 96 patients Participant exclusion criteria 1. Aged over 60 years 2. Serious medical diagnosis...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 386 ]
Welcome to Sal-Site
Updated:
(Jan 26, 2006)
Rate Avg:
(
no ratings
)
(
no ratings
)
...behavior capture the attentionof students of all ages, making them perfect for teaching science. These...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Sal-Site: integrating new and existing ambystomatid salamander research and informational resources.
(Dec 16, 2005)
Sal-Site: integrating new and existing ambystomatid salamander research and informational resources.
(Dec 16, 2005)
[ 387 ]
Hochschule Hamm-Lippstadt - Prof. Dr. Robin Nunkesser
Updated:
(Dec 10, 2007)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Engineer und Consultant bei der ELCA Informatik AG, einem groÃen Individualsoftwarehersteller der Schweiz, tÃ...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Detecting high-order interactions of single nucleotide polymorphisms using genetic programming.
(Dec 15, 2007)
Detecting high-order interactions of single nucleotide polymorphisms using genetic programming.
(Dec 15, 2007)
[ 388 ]
Allen Brain Atlas - Home
Updated:
(Mar 2, 2007)
Rate Avg:
(
no ratings
)
(
no ratings
)
...histopathologic signatures of the brain in normal aging, disease and injuryReference AtlasesHigh resolution mouse and...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 389 ]
Society of Urologic Oncology :: Home
Updated:
(Feb 15, 2005)
Rate Avg:
(
no ratings
)
(
no ratings
)
...of MH problems between PC survivors and ...-matched men from the general population (GenPop...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Highlights from the Society of Urologic Oncology 4th annual meeting.
(Mar, 2005)
Highlights from the Society of Urologic Oncology 4th annual meeting.
(Mar, 2005)
[ 390 ]
WebCite query result
Updated:
(Mar 5, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...criteria Potential participants are carers of children aged 5 years or less, and whose children have a diagnosis of eczema on their GP record.; Target Gender: Male & Female; Upper ... Limit 5 years Participants - exclusion criteria GPs...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 391 ]
ISRCTN15835424
Updated:
(Apr 30, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...2017 Reason abandonedEligibilityParticipant inclusion criteria 1. Patient ... >18 years2. Histologically diagnosed Prostate cancer, stages T1b-T3bN0M03. Any Gleason score4. Any PSA level5. Patient able to consent and fill in the questionnaires Participant type Patient ... group Adult Gender Male Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 392 ]
WebCite query result
Updated:
(Apr 20, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Participants - inclusion criteria 1. Middle- to older-aged (45+ years of ...), either sex 2. Greek-born or Italian...about depression designed for middle- to older-aged consumers from a non-English speaking background...studies are representative of middle- to older-aged people of both genders who are Greek...variables and clinical history such as: 1. ... 2. Gender 3. Birthplace 4. Marital status...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 393 ]
Sockeye Main Page — Canada's Michael Smith Genome Sciences Centre
Updated:
(May 4, 2004)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Hassel M., Melsopp C., Rak M., Robertson A.G., Sleumer M., Siddiqui A.S., and Jones S.J.M....
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 394 ]
Solutions for Pharmaceutical Testing - Sotax AG
Updated:
(Oct 17, 2000)
Rate Avg:
(
no ratings
)
(
no ratings
)
...TestingNIR (PAT)Cap Torque TestingCopyright © SOTAX AG 2017, all rights reservedFooter NavigationTerms of UsePrivacy...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 395 ]
ISRCTN - ISRCTN93702927: Snow Control
Updated:
(Nov 29, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...08/2011 Reason abandonedEligibilityParticipant inclusion criteria 1. ... between 17 - 652. High speed internet accessParticipant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 396 ]
Wisconsin Longitudinal Study Homepage
Updated:
(Mar 3, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Research Program of the National Institute on Aging. To summarize the data we suggest you...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 397 ]
BirdsEyeView
Updated:
(Oct 10, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...22000 rows, "," csv format )source:http://www.ag.unr.edu/mittler/Example3 integrated file test...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 398 ]
WebCite query result
Updated:
(Apr 24, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...criteria 1. 100 male and female volunteers aged between 18-65 years will be recruited...s) Demographic and descriptive details of participants ..., gender, ethnicity Sources of funding 1. Bournemouth...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 399 ]
Lewis-Sigler Institute | for Integrative Genomics
Updated:
(Jan 26, 2005)
Rate Avg:
(
no ratings
)
(
no ratings
)
...formSearch ResearchFacilitiesCenter for Quantitative BiologyGlenn Laboratories For Aging ResearchFaculty PublicationsFaculty Research LabsPeopleDirectoryFaculty Research SummaryFacultyAssociate Research...msl2@princeton.eduColeen MurphyResearch: Molecular mechanisms of aging ctmurphy@princeton.eduJoshua D. RabinowitzResearch: Quantitative and...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[World trends of systems biology related to the genome network project]
(Dec, 2004)
[World trends of systems biology related to the genome network project]
(Dec, 2004)
[ 400 ]
FMP Berlin: FMP Home FMP Home - fmp-berlin.de
Updated:
(Feb 25, 2005)
Rate Avg:
(
no ratings
)
(
no ratings
)
...processes and corresponding diseases, such as cancer, aging including osteoporosis, or neurodegeneration. They also develop...pm Chemical Biology SeminarSeminar Chemische BiologieSimon Klenk, AG Hackenberger, Berlin, DeutschlandMay 10 09:00 am...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
COPS--cis/trans peptide bond conformation prediction of amino acids on the basis of secondary structure information.
(Mar 1, 2005)
COPS--cis/trans peptide bond conformation prediction of amino acids on the basis of secondary structure information.
(Mar 1, 2005)
[ 401 ]
Fragile X Syndrome Screening Study
Updated:
(Sep 11, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...to Victorian women over 18 years of ... who are either not currently pregnant or...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 402 ]
TiRe | Home
Updated:
(Jul 25, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...PhD Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 403 ]
MethTools
Updated:
(Apr 24, 2000)
Rate Avg:
(
no ratings
)
(
no ratings
)
...to use this software. Leibniz Institute for ... Research - Fritz Lipmann Institute Genome Analysis Beutenbergstr...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
MethTools--a toolbox to visualize and analyze DNA methylation data.
(Mar 1, 2000)
MethTools--a toolbox to visualize and analyze DNA methylation data.
(Mar 1, 2000)
[ 404 ]
Coffea Genome Projects
Updated:
(Mar 1, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Carlos A Colombo , Luiz GE Vieira , Goncalo AG Pereira and Brazilian Coffee Genome Project Consortium...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 405 ]
Karger Publishers
Updated:
(Mar 10, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...worldwide such asMore details© 2017 S. Karger AG, Basel Karger International: COM | DE | CNSwitch to...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 406 ]
WebCite query result
Updated:
(Mar 6, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...district.CriteriaInclusion Criteria:Girls in the target ... range who were able to visit the study centre and didn't have any significant illness preventing participation were considered eligible.Exclusion Criteria:•... not between 15 and 18 yearsany apparent...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 407 ]
Health topics - WHO | Regional Office for Africa
Updated:
(Mar 19, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Adolescent health Female genital mutilation Malaria Rabies Ageing Food safety Marburg haemorrhagic fever Research Alcohol...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Blood transfusion safety in Africa: a literature review of infectious disease and organizational challenges.
(Apr, 2012)
Blood transfusion safety in Africa: a literature review of infectious disease and organizational challenges.
(Apr, 2012)
[ 408 ]
ISRCTN - ISRCTN20236112: An investigation of the dietary requirements for vitamin D
Updated:
(Apr 21, 2009)
Rate Avg:
(
no ratings
)
(
no ratings
)
...criteria 1. Consenting adult men and women2. Aged 20 - 85 years3. In general good health Participant type Patient ... group Adult Gender Both Target number of...in free-living adults >=64 y of ...., Am. J. Clin. Nutr., 2009, 89, 5...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Estimation of the dietary requirement for vitamin D in free-living adults >=64 y of age.
(May, 2009)
Estimation of the dietary requirement for vitamin D in free-living adults >=64 y of age.
(May, 2009)
[ 409 ]
The Laboratory of Cytomolecular Genetics (CMG)
Updated:
(Dec 13, 2004)
Rate Avg:
(
no ratings
)
(
no ratings
)
...of research career of young researchers No ... discriminationWhat does CMG group offer to you...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 410 ]
WebCite query result
Updated:
(Apr 30, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...2017 Reason abandonedEligibilityParticipant inclusion criteria 1. Patient ... >18 years2. Histologically diagnosed Prostate cancer, stages T1b-T3bN0M03. Any Gleason score4. Any PSA level5. Patient able to consent and fill in the questionnaires Participant type Patient ... group Adult Gender Male Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 411 ]
WebCite query result
Updated:
(Jul 13, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...months post op Eligibility Key inclusion criteria1 ... range: Greater than or equal to 18 years of .... 2 Able to give informed consent and willingness to participate in follow up. 3 Undergoing any plastic surgery procedure involving excision of skin lesionsMinimum age18 YearsMaximum ... No limitGenderBoth males and femalesCan healthy volunteers...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 412 ]
Fields Lab - Research
Updated:
(Dec 3, 2001)
Rate Avg:
(
no ratings
)
(
no ratings
)
...studies of cancer-associated proteins, polyglutamine aggregation, aging, Toll-like receptors and malaria. Technology development...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 413 ]
INCF XNAT Datashare
Updated:
(Jun 6, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...1005)Patient's Birth Name(0010, 1010)Patient's ...(0010, 1040)Patient's Address(0010, 1060)Patient's...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 414 ]
BU | Phylogeny of Sleep
Updated:
(May 6, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...problems affect men and women of every ..., race, and socioeconomic class.Despite the costs...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 415 ]
SCOP: Structural Classification of Proteins
Updated:
(Oct 9, 2001)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Brenner S.E., Hubbard T.J.P., Chothia C., Murzin A.G. (2004). SCOP database in 2004: refinements integrate structure and sequence family data. Nucl. Acid Res. 32:D226-D229. [PDF], and Andreeva A., Howorth D., Chandonia J.-M., Brenner S.E., Hubbard T.J.P., Chothia C., Murzin A.G. (2007). Data growth and its impact on...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 416 ]
School of Health and Population Sciences - University of Birmingham
Updated:
(Oct 31, 2006)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Clinical SciencesDentistryGraduate SchoolImmunology and Immunotherapy Inflammation and Ageing MedicineMetabolism and Systems ResearchMicrobiology and InfectionNursingPharmacyCollege of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Citation classics in patient safety research: an invitation to contribute to an online bibliography.
(Oct, 2006)
Citation classics in patient safety research: an invitation to contribute to an online bibliography.
(Oct, 2006)
[ 417 ]
WebCite query result
Updated:
(Jul 24, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...studiedObesity, Prevention, Computer tailoring- Inclusion criteria1. Adult (aged 25-65 years); 2. BMI 25-30...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 418 ]
Panamath
Updated:
(Aug 19, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...assess their students, and anyone of any ... can test themselves.Panamath is completely free...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 419 ]
ISRCTN65176374
Updated:
(Jun 19, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...We intend to minimise on three factors; ... (18 - 39 years versus 40 - 65 years...data will be collected:4. Demographic data - ..., sex, reason for ICU admission5. Duration of...03/2010 Reason abandonedEligibilityParticipant inclusion criteria 1. Aged between 18 and 65 years, either sex2...participate in this study Participant type Patient ... group Adult Gender Both Target number of participants 64 Participant exclusion criteria 1. Lack of consent 2. Aged less than 18 or greater than 65...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 420 ]
WebCite query result
Updated:
(Dec 2, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...1. Male and female patients over the ... of 18 years suffering from asthma2. Have...six months before recruitment. Participant type Patient ... group Adult Gender Both Target number of participants 96 patients Participant exclusion criteria 1. Aged over 60 years 2. Serious medical diagnosis...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 421 ]
WebCite query result
Updated:
(Oct 29, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...s) studiedAlcohol abuse- Inclusion criteria1. Men/women ... 18+; 2. AUDIT score >8; 3. Drinking...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 422 ]
trial data
Updated:
(Aug 21, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...alcohol use among heavy drinkers in the ages between 18 and 24 years in a...Problem(s) studiedAdolescents, Alcohol- Inclusion criteria1. Adolescents aged between 18 and 24 years, either sex...alcohol use among heavy drinkers in the ages between 18 and 24 years in a...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 423 ]
DFCI SAGE Database
Updated:
(Dec 29, 2004)
Rate Avg:
(
no ratings
)
(
no ratings
)
...2005; 132:415-427. Fetal (post-coital) ... E12.5 E13.5 E15.5 Fetal...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 424 ]
ISRCTN15789289
Updated:
(Jul 29, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...cancer-related information.Who can participate? Adults aged 18-40, attending college and happy to...07/2013 Reason abandonedEligibilityParticipant inclusion criteria 1. Aged 18â40 years2. Attending college3. Consenting to play video games Participant type Healthy volunteer ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 425 ]
WebCite query result
Updated:
(Jan 16, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Control_9 Interventions/Control_10Eligibility Item Value ...-lower limit 20 years-old ...-upper limit 90 years-old >= Gender Male...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 426 ]
Memorial University of Newfoundland - Faculty of Medicine
Updated:
(Jun 28, 2007)
Rate Avg:
(
no ratings
)
(
no ratings
)
...colorectal tumours are characterized by an early ... of onset and are found predominantly in...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
A new variant database for mismatch repair genes associated with Lynch syndrome.
(Jul, 2007)
A new variant database for mismatch repair genes associated with Lynch syndrome.
(Jul, 2007)
[ 427 ]
ISRCTN - ISRCTN92202008: Can Repellents Prevent Malaria in Africa?
Updated:
(Oct 28, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...18 years, either sex Participant type Patient ... group Adult Gender Both Target number of participants 4819 Participant exclusion criteria Under six months of ... Recruitment start date 30/08/2009 Recruitment...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 428 ]
Health, Demographic Change and Wellbeing - European Commission
Updated:
(Jul 6, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...the causes and mechanisms underlying health, healthy ageing and disease;improve our ability to monitor...European Innovation Partnership on Active and Healthy Ageing, the Global Alliance for Chronic Diseases, theÂ...European Innovation Partnership on Active and Healthy Ageing (EIP on AHA) to ensure the wider...EDCTP)Innovation Partnership on Active and Healthy Ageing Active and assisted Living ProgrammeEU health research...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 429 ]
Menopause : Nature Reviews Disease Primers
Updated:
(May 18, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...service | Purchase a site licenseMenopause is the ...-related (primary) or iatrogenic (secondary) loss of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 430 ]
Programmes | Sanger Institute
Updated:
(Jun 14, 2007)
Rate Avg:
(
no ratings
)
(
no ratings
)
...s genomic studies.Our VisionExplore Our ResearchCancer, Ageing and Somatic MutationCellular GeneticsHuman GeneticsInfection GenomicsMalariaSanger Institute...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
The landscape of histone modifications across 1% of the human genome in five human cell lines.
(Jun, 2007)
Accurate and reliable high-throughput detection of copy number variation in the human genome.
(Dec, 2006)
Copy number variation: new insights in genome diversity.
(Aug, 2006)
Multiplex sequencing of 1.5 Mb of the Mycobacterium leprae genome.
(Aug, 1997)
The landscape of histone modifications across 1% of the human genome in five human cell lines.
(Jun, 2007)
Accurate and reliable high-throughput detection of copy number variation in the human genome.
(Dec, 2006)
Copy number variation: new insights in genome diversity.
(Aug, 2006)
Multiplex sequencing of 1.5 Mb of the Mycobacterium leprae genome.
(Aug, 1997)
[ 431 ]
j.gene.2013.10.026
Updated:
(Jul 26, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...the loss of ovarian function before the ... of 40 years. It is biochemically characterized by low levels of gonadal hormones (estrogens and inhibins) and high levels of gonadotropins (luteinizing hormone [LH] and follicle stimulating hormone [FSH]) (de Moraes-Ruehsen and Jones, 1967). It affects approximately 10 per 100,000 person-years in those aged 15 to 29 years and 79 per...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 432 ]
WebCite query result
Updated:
(May 25, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...gov numberProtocol/serial number JUST/2010/DPIP/AG/0914-30-CE-0379823/00-48 Study...2013 Reason abandonedEligibilityParticipant inclusion criteria 1. Participants' ... between 16 and 18 years2. A positive screen on the CRAFFT for risky substance use3. Informed consent of the participants4. Access to the internet Participant type Patient ... group Child Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 433 ]
Startseite - OR.NET | Projektwebsite
Updated:
(Apr 21, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...GE » ARCHIVVorstandVorsitzender:Dr. Frank Portheine, SurgiTAIX AG, HerzogenrathStellvertretender Vorsitzender:Prof. Thomas Neumuth, ICCAS, UniversitÃ...Standardisierung:Dr. Stefan Schlichting, Drägerwerk AG & Co. KGaA , LübeckVorstand Risikomanagement und Zulassung:Dr...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 434 ]
Gemina
Updated:
(Dec 22, 2009)
Rate Avg:
(
no ratings
)
(
no ratings
)
...unique outbreak metadata including location, date, host ... and host gender). Selection Summary Controlled Vocabulary(0) Pathogens(0) Toxins(0) Hosts(0) Reservoirs(0) Environmental Sources(0) Diseases(0) Anatomy(0) Transmission Methods(0) Symptoms(0) LocationCategorical DataGender: Male FemaleAge(s): years X ... Formats: Single Year: 19Age Range: 19-25...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
GeMInA, Genomic Metadata for Infectious Agents, a geospatial surveillance pathogen database.
(Jan, 2010)
GeMInA, Genomic Metadata for Infectious Agents, a geospatial surveillance pathogen database.
(Jan, 2010)
[ 435 ]
Z score calculator of coronary arterial diameter
Updated:
(Aug 6, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...the pediatric cardiovascular section were enrolled. The ... distribution is from 0 month to 18.9 years old and median ... is 6 years 7 months.Statistical methodLMS...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 436 ]
Healthy Living - Department of Design and Construction
Updated:
(Jan 16, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...and Development, the Department for the Aging.Directory of City Agencies Contact NYC Government...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Developing and implementing the Active Design Guidelines in New York City.
(Jan, 2012)
Developing and implementing the Active Design Guidelines in New York City.
(Jan, 2012)
[ 437 ]
ISRCTN - ISRCTN38950042: The Functional Fitness MOT test battery for older adults
Updated:
(Jun 21, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...needs to for independent living, for people aged 60 years and over. It involves six simple physical tests, for example walking and stretching, to assess how fit older people compared to what is considered normal for their ... and sex. The test results will be...FFMOT test results.Who can participate? Adults aged at least 60 who are not very...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 438 ]
MitoBreak — The mitochondrial DNA breakpoints database
Updated:
(Dec 30, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...the mitochondrial mutator miceList of deletions from aging Drosophila melanogasterNavigationHome | Datasets | Classifier |...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 439 ]
VA Website Maintenance
Updated:
(Aug 28, 2003)
Rate Avg:
(
no ratings
)
(
no ratings
)
...DayMemorial DayCelebrating America's FreedomsSpecial EventsCreative Arts FestivalGolden ... GamesSummer Sports ClinicTraining–Exposure– Experience (TEE) TournamentWheelchair...OfficeProgram OverviewFAQLatest AnnouncementsGrant PogramTraining AllowancesContactCreative Arts FestivalGolden ... GamesSummer Sports ClinicTraining - Exposure - Experience - TournamentWheelchair GamesWinter...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 440 ]
REDUCE
Updated:
(May 7, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Group MembersEducation Overview Research Overview Metabolism and Ageing NetworkMitochondria and AgeingNetwork InferenceParameter Estimation and Ensemble...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 441 ]
NASA Spitzer Space Telescope
Updated:
(May 16, 2007)
Rate Avg:
(
no ratings
)
(
no ratings
)
...was just 4 percent of its current ..., is rich in dust., Image Credit: ESO...was only 4 percent of its present .... This galaxy was observed shortly after its...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 442 ]
King's College London - Imaging Analysis
Updated:
(Mar 9, 2009)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Adolescent PsychiatryForensic & Neurodevelopment ScienceHealth Service & Population ResearchNeuroimagingOld ... PsychiatryPsychological MedicinePsychologyPsychosis StudiesSocial, Genetic & Development Psychiatry Centre (MRC)MRC Centre for Developmental NeurobiologyWolfson Centre for ... Related Diseases (CARD)The Dickson Poon School...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Measuring fMRI reliability with the intra-class correlation coefficient.
(Apr 15, 2009)
Measuring fMRI reliability with the intra-class correlation coefficient.
(Apr 15, 2009)
[ 443 ]
WebCite query result
Updated:
(May 24, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Design Outcome Measures Participant DetailsNumber Enrolled Gender ... Group IdentifiersNCT Number Other IDs Title Acronym...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 444 ]
The Smith Lab | Computational Genomics Research
Updated:
(Nov 29, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...be influenced by environmental exposure, diet and aging, and aberrant methylation is a hallmark of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Site identification in high-throughput RNA-protein interaction data.
(Dec 1, 2012)
Site identification in high-throughput RNA-protein interaction data.
(Dec 1, 2012)
[ 445 ]
DYNAMCC
Updated:
(Sep 16, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...May 19 2016Pines G, Pines, A, Garst, AG, Zeitoun, RI, Lynch, SA, and Gill, RT...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 446 ]
Morris Lab | Software
Updated:
(Oct 26, 2009)
Rate Avg:
(
no ratings
)
(
no ratings
)
...and purification Quon, G., Haider, S., Deshwar, A.G., Cui, A., Boutros, P.C., Morris, Q.D. (2013...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
ISOLATE: a computational strategy for identifying the primary origin of cancers using high-throughput sequencing.
(Nov 1, 2009)
ISOLATE: a computational strategy for identifying the primary origin of cancers using high-throughput sequencing.
(Nov 1, 2009)
[ 447 ]
ISRCTN39701540
Updated:
(May 25, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...criteria Consecutive IC-patients (>18 years of ...) transported by the Mobile Intensive Care Unit, Academic Medical Center, University of Amsterdam. Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 448 ]
ISRCTN - ISRCTN37457227: National Adolescent Treatment Trial for Obesity in Kuwait
Updated:
(Jun 30, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...on US CDC 200 BMI charts)3. Aged 10 - 14 years inclusive4. With no major chronic disease or disability5. With no obvious underlying pathological cause of obesity6. At least one parent willing to attend treatment sessions if randomly allocated to intervention7. Attending a mainstream school in the public sector Participant type Patient ... group Child Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 449 ]
Fungal Genetics Stock Center
Updated:
(Dec 12, 2005)
Rate Avg:
(
no ratings
)
(
no ratings
)
...index) Twitter FGSC Curator on Kansas Ag Today Radio Fungal Genetics...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 450 ]
MASiVE @ the BAT cave
Updated:
(Sep 24, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...lengths, and an estimation of the insertion ... based on the divergence of the two...10272 . + . ID=example-D-1126;length=9147;...=1.1654 example...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
MASiVE: Mapping and Analysis of Sirevirus Elements in plant genome sequences.
(Oct 1, 2010)
MASiVE: Mapping and Analysis of Sirevirus Elements in plant genome sequences.
(Oct 1, 2010)
[ 451 ]
WebCite query result
Updated:
(Jan 9, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...alcohol use among heavy drinkers in the ages between 18 and 24 years in a...Problem(s) studiedAdolescents, Alcohol- Inclusion criteria1. Adolescents aged between 18 and 24 years, either sex...alcohol use among heavy drinkers in the ages between 18 and 24 years in a...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 452 ]
index
Updated:
(Apr 30, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...in children younger than 4 years of .... (1-3) Considerable financial and personal resources...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 453 ]
WebCite query result
Updated:
(Mar 24, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...students from high schools in the Netherlands, aged between 12 and 30. Participants - exclusion criteria...assessed in the Smoke Alert-questionnaire are ..., gender, educational level and level of physical...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 454 ]
nutrition
Updated:
(Nov 21, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...across the range of outcomes, settings and ... ranges relevant to child obesity research.The...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 455 ]
WebCite query result
Updated:
(Jul 29, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...cancer-related information.Who can participate? Adults aged 18-40, attending college and happy to...inclusion criteria Inclusion criteria were:1. Being aged 18â40 years2. Attending college3. Consenting to play video games Participant type Healthy volunteer ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 456 ]
STORE_DB
Updated:
(Jul 20, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...and survival in mice in dependence of ... after X-ray and neutron exposureCreated on...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 457 ]
ISRCTN - ISRCTN34151616: Supplementation with Multiple Micronutrients Intervention Trial
Updated:
(Mar 19, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...of children at 8-11 years of ... whose mothers had consumed multiple micronutrient supplements...Emotional Development and Health and Morbidity at ... 42 months3. Child Anthropometry and nutritional status, including dietary habits, at ... 42 months4. Child Hemoglobin concentration at ... 42 months5. An adapted version of the...Inclusion criteria: Confirmed pregnancy of any gestational ... by physical exam or urine test and consenting to be involved in the study. Participant type Patient ... group Adult Gender Female Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 458 ]
WebCite query result
Updated:
(Nov 23, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...duration is required.EligibilityAge-lower limit18years-old...-upper limit28years-old>=GenderMale and FemaleKey inclusion criteria1) are between 18 and 28 year of ...; 2) own a smart phone running an...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 459 ]
Accueil
Updated:
(Sep 11, 2006)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Earth Choutuppal Maheshwaram Expériences de traçages sur le site de Ploemeur Site expérimentale...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 460 ]
ISRCTN76496973
Updated:
(Sep 12, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...risk of CIN.Who can participate?Patients aged over 18 who are undergoing diagnostic/treatment...3. Informed consent4. Both male and female, ... > 18 years (no upper limit) Participant type Patient ... group Adult Gender Both Target number of participants 76 Participant exclusion criteria 1. ... ...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 461 ]
Clinical Predictions from Structural Brain MRI | MGH/HST Martinos Center for Biomedical Imaging
Updated:
(Jan 23, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...cross-sectional MRI data in young, middle aged, nondemented, and demented older adults. Journal of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 462 ]
ISRCTN91623132
Updated:
(Sep 18, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...via an online access panel (called respondi AG) in Germany.What does the study involve...collection was done in collaboration with respondi AG Cologne.When is the study starting and...member of the online access panel respondi AG Cologne2. Having Internet access3. Having command of the German language4. Being at least 18 years old Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 463 ]
WebCite query result
Updated:
(Feb 4, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...consent 3. Is seriously considering weight reduction4. Aged over 20 years, either sex5. Has a...pill at randomisation date Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 464 ]
BiDaS
Updated:
(Jun 24, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...transition and distribution properties, GC content, Purine (AG) content, Keto (GT) content etc. RN (N...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
BiDaS: a web-based Monte Carlo BioData Simulator based on sequence/feature characteristics.
(Jul, 2013)
BiDaS: a web-based Monte Carlo BioData Simulator based on sequence/feature characteristics.
(Jul, 2013)
[ 465 ]
www.uk-itp.org
Updated:
(Dec 14, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...is open to all patients between the ages of 2 months and 18 years that...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 466 ]
Home | AHRQ Effective Health Care Program
Updated:
(Dec 9, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Protocol Mar. 24, 2017 Interventions to Prevent ...-Related Cognitive Decline, Mild Cognitive Impairment, and...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 467 ]
Home - DASH
Updated:
(Sep 29, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...article publishedFindings from the feasibility study at ... 21-23 years have been published as...health for everyone from childhood to old ....Find out more Why is DASH...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 468 ]
Digital Atlas of the Pediatric Chest | Seattle Children’s Hospital
Updated:
(Feb 6, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...resources and is provided to children under ... 21 whose primary residence is in Washington...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 469 ]
Welcome to NanoMiner
Updated:
(Jul 22, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Jurkat)ZnO-1 (IBU-tec advanced materials AG), ZnO-2 (mandelic acid coated ZnO-1...Jurkat)ZnO-1 (IBU-tec advanced materials AG), TiO2 (Evonik Degussa, Aeroxide TiO2 p25)90GSE14910...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
NanoMiner - Integrative Human Transcriptomics Data Resource for Nanoparticle Research.
(2013)
NanoMiner - Integrative Human Transcriptomics Data Resource for Nanoparticle Research.
(2013)
[ 470 ]
ISRCTN24874457
Updated:
(Jan 20, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...criteria 1. 18 to 75 years of ..., either sex2. Type one or type two diabetes (diagnosed by physician)3. Minor to moderate depression (Center for Epidemiological Studies Depression Scale [CES-D] more than 16) 4. Easy acces to the Internet Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 471 ]
ISRCTN - ISRCTN90543844: Effects of calcium fructoborate on markers of subclinical atherosclerosis
Updated:
(Jan 17, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...trial will include healthy men and women, ... 40-60. What does the study involve...inclusion criteria 1. Male or female patients aged 40-602. Gender ratio: 50% females and...consent obtained at selection Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 472 ]
CKD Pathway - The Pathway
Updated:
(Aug 18, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...proteinuriaInvestigate for urinary tract malignancy in appropriate ... groupsWith ACR >3 mg/mmolRefer to nephrologist...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 473 ]
ISRCTN - ISRCTN61562706: PRAZosin for patients with Obsessive Compulsive disorder
Updated:
(Feb 22, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...dose and duration 4. Male and female, aged between 18-70 years5. Female patients of childbearing potential must have a negative pregnancy test and use a reliable method of contraception6. Written informed consent Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 474 ]
Computational Biology of RNA Processing | Bioinformatics and Genomics @ CRG
Updated:
(Jan 26, 2005)
Rate Avg:
(
no ratings
)
(
no ratings
)
...of genes Genome Biology 2016 Corrigendum: Synchronized ...-related gene expression changes across multiple tissues...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[Identification of functional elements based on comparative genomics]
(Dec, 2004)
[Identification of functional elements based on comparative genomics]
(Dec, 2004)
[ 475 ]
INTERSNP - Genome-wide Interaction Analysis Software
Updated:
(Dec 7, 2009)
Rate Avg:
(
no ratings
)
(
no ratings
)
...is now maintained and extended by the AG Genomic Mathematics in Neuroepidemiology at the German...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
INTERSNP: genome-wide interaction analysis guided by a priori information.
(Dec 15, 2009)
INTERSNP: genome-wide interaction analysis guided by a priori information.
(Dec 15, 2009)
[ 476 ]
Institut de Biologie Intégrative de la Cellule
Updated:
(Feb 13, 2003)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Spectroscopies Electroniques Spectroscopies Vibrationelles PARi Séquenç... à haut débit Biologie Moléculaire...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Towards a computational model for -1 eukaryotic frameshifting sites.
(Feb 12, 2003)
Towards a computational model for -1 eukaryotic frameshifting sites.
(Feb 12, 2003)
[ 477 ]
Research Overview | Desaire Research Team
Updated:
(Sep 16, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...race, color, ethnicity, religion, sex, national origin, ..., ancestry, disability, status as a veteran, sexual...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 478 ]
Directory of P450-containing Systems
Updated:
(Feb 13, 1997)
Rate Avg:
(
no ratings
)
(
no ratings
)
...images of known 3D structuresThe table of ...-dependent changes in liver microsomal P450 by...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 479 ]
Interstitial Lung Disease Atlas | Seattle Children’s Hospital
Updated:
(Oct 5, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...resources and is provided to children under ... 21 whose primary residence is in Washington...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Interactive High-resolution Computed Tomography Digital Atlas of Interstitial Lung Disease.
(Nov, 2011)
Interactive High-resolution Computed Tomography Digital Atlas of Interstitial Lung Disease.
(Nov, 2011)
[ 480 ]
resources - SjD Laboratory
Updated:
(May 7, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...over-expression, and also correlated with the ... of onset of cancer, aggressiveness of the...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 481 ]
Informcare
Updated:
(Oct 7, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...social innovations which support active and healthy ageing. The project will develop and test, as...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 482 ]
Reference Datasets | Computational Mass Spectrometry
Updated:
(Mar 4, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...with three or... 24727770PASS00289Targeted proteomics coming of ... - SRM, PRM and DIA performance evaluated from...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 483 ]
CIFASD – Collaborative Initiative on Fetal Alcohol Spectrum Disorders
Updated:
(Apr 12, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...tree was tested on children in 2 ... groups (5-7 years and 10-16...response) in infants at 6 months of ... was better than the Bayley's test of development in predicting both normal and impaired infant performance at 12 months of ....Read moreResearchers Find That Simple Test May...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 484 ]
WebCite query result
Updated:
(May 30, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...a web-based treatment for young people aged 12-22 with symptoms of depression. The...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 485 ]
ipti - Drugs resistance maps - Mapping the distribution of resistance genes of malaria in Africa
Updated:
(Sep 19, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...in infants up to 12 months of ... (Aponte JJ et al 2009,The Lancet...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Drug resistance maps to guide intermittent preventive treatment of malaria in African infants.
(Oct, 2011)
Drug resistance maps to guide intermittent preventive treatment of malaria in African infants.
(Oct, 2011)
[ 486 ]
www.nric.org.uk
Updated:
(Oct 18, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...of vaccines to protect people of all ages against disease. Immunization saves millions of lives...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 487 ]
Urinary and Bowel Incontinence
Updated:
(Aug 21, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...U.S. Preventive Services Task Force advised men aged 55 to 69 to discuss the pros...screening still outweigh the benefits for this ... group. Since the last guidelines came out in 2012, new evidence has emerged suggesting that PSA tests may help lower the odds that tumors spread to other parts of the body or prove fatal for men aged 55 to 69, said task force chair...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 488 ]
WebCite query result
Updated:
(Jul 30, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...studiedPanic disorder- Inclusion criteria1. 18 years of ... or older; 2. Internet access; 3. Sub...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 489 ]
Palliative Care Victoria, Palliative Care Services Resources
Updated:
(Nov 1, 2007)
Rate Avg:
(
no ratings
)
(
no ratings
)
...supportPalliative care is for people of all ages with life limiting illnesses and their familiesAn...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 490 ]
Discover HeartScore
Updated:
(Aug 6, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...high & low cardiovascular risk) based on gender, ..., total cholesterol, systolic blood pressure and smoking...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 491 ]
University of Birmingham - University of the Year for graduate employment
Updated:
(Aug 14, 2002)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Clinical SciencesDentistryGraduate SchoolImmunology and Immunotherapy Inflammation and Ageing MedicineMetabolism and Systems ResearchMicrobiology and InfectionNursingPharmacyCollege of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 492 ]
ISRCTN70447230
Updated:
(Jan 6, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...between 30 and 45 Watts, depending on ..., height, weight, and gender. The cycling resistance...a cardiopulmonary ergospirometry device (Schiller CS200, Schiller AG, Switzerland). Oxygen uptake capacity (VO2), respiratory exchange...care nurses, 3 physicians)2. Between the ages 18 and 65 years, either sex3. Working at the Jessa Hospital, Hasselt, Belgium4. Subjects were required to be able to achieve a maximal voluntary cardiopulmonary exercise test Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 493 ]
Improving End-of-Life Care in First Nations Communities |
Updated:
(May 11, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Nations people is increasing due to an aging population and the high burden of chronic...the Centre for Education and Research on Aging & Health (CERAH) at Lakehead University, and was...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 494 ]
Psych Grad
Updated:
(Jul 12, 2001)
Rate Avg:
(
no ratings
)
(
no ratings
)
...5, 2016 Marty 0In this day and ..., family bonding is something that people just...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 495 ]
WebCite query result
Updated:
(Jan 16, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...participate? Participants can be of either sex, aged between 16-30 and resident in the...07/2015 Reason abandonedEligibilityParticipant inclusion criteria 1. Aged 16-302. Resident in the London boroughs of Southwark and Lambeth3. Sexually active (at least 1 sexual partner in last 12 months)4. Access to the internet (smart phone, PC or laptop)5. Willing to take an STI test Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 496 ]
Bowling Alone
Updated:
(Jan 19, 2004)
Rate Avg:
(
no ratings
)
(
no ratings
)
...shows how changes in work, family structure, ..., suburban life, television, computers, womenâs...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
On the importance of age-adjustment methods in ecological studies of social determinants of mortality.
(Dec, 2003)
On the importance of age-adjustment methods in ecological studies of social determinants of mortality.
(Dec, 2003)
[ 497 ]
ISRCTN - ISRCTN93952605: Educational intervention for atrial fibrillation
Updated:
(Sep 16, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...referred for, and accepting of, anticoagulant therapy2. Aged 18 years or older, either sex Participant type Patient ... group Adult Gender Both Target number of participants 200 Participant exclusion criteria 1. Aged less than 18 years old2. Have any...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 498 ]
ISRCTN41034162
Updated:
(Mar 18, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Reason abandonedEligibilityParticipant inclusion criteria Stage One:1. Aged 16 or above, either sex2. Based in...Eating Disorders Examination Interview Participant type Patient ... group Adult Gender Both Target number of participants 250 participants Participant exclusion criteria Stage One:1. Under the ... of 16 2. Do not fulfil the...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 499 ]
Biostatistique Toulouse www.biostat.envt.fr - Reference Value Advisor
Updated:
(Mar 3, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...EP28A reference interval can change with covariates (..., weight,...) leading to a reference interval to...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 500 ]
ISRCTN00029383
Updated:
(Jan 4, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...reading by principal investigator Participant type Patient ... group Adult Gender Both Target number of...trifascicular block9. Ongoing pregnancy. Women of childbearing ... should be using reliable contraception.10. Acute...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 501 ]
WebCite query result
Updated:
(Dec 9, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...to normal practice Inclusion Criteria ... From 40.00 Year(s)... To 85.00 Year(s)Gender Both...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 502 ]
MDRD.COM
Updated:
(May 28, 2008)
Rate Avg:
(
no ratings
)
(
no ratings
)
...with SI Units)using standardized serum creatinine, ..., race, gender and serum cystatin C programmed...equations to estimate kidney function in persons aged 70 years or older. Ann Intern Med...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 503 ]
Volume 2: Evolution and Selection of Quantitative Traits
Updated:
(Mar 8, 2000)
Rate Avg:
(
no ratings
)
(
no ratings
)
...12. Selection Under Crossbreeding 13. Selection in ...-structured Populations V. Population-Genetics Models of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 504 ]
WebCite query result
Updated:
(Nov 8, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Inclusion criteria1. Diagnosed with malignant lymphoma; 2. ... 18 or older; 3. Having internet access at home; 4. At least one (follow up) consultation per year.- Exclusion criteria1. ... under 18; 2. Not having internet access...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 505 ]
WebCite query result
Updated:
(Jul 30, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Inclusion criteria1. Diagnosed with malignant lymphoma; 2. ... 18 or older; 3. Having internet access at home; 4. At least one (follow up) consultation per year.- Exclusion criteria1. ... under 18; 2. Not having internet access...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 506 ]
HADb : Human Autophagy Database
Updated:
(Jun 17, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...diverse pathologies, including infections, cancer, neurodegeneration and aging as well as in heart, liver and...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 507 ]
WebCite query result
Updated:
(Dec 24, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...for the development of liver metastases. Patients aged >=18 years. Exclusion criteria: Children or adolescents (under the ... of 18 years). Studies that do not...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 508 ]
Scotland's Health on the Web - Putting Scotland's Health on the Web
Updated:
(May 31, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...children and young people up to the ... of 18 who may be going through...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[Meta-analysis of calcineurin inhibitor in the treatment of lupus nephritis].
(Apr, 2011)
[Meta-analysis of calcineurin inhibitor in the treatment of lupus nephritis].
(Apr, 2011)
[ 509 ]
Isabel A. Nepomuceno-Chamorro # BioInformatics Group Seville
Updated:
(Jan 11, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...of neurofibrillary tangles in alzheimer's disease. Neurobiol. Aging 2006;27:1359-1371 (2006). ...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Prognostic transcriptional association networks: a new supervised approach based on regression trees.
(Jan 15, 2011)
Prognostic transcriptional association networks: a new supervised approach based on regression trees.
(Jan 15, 2011)
[ 510 ]
A systematic review of pediatric shared decision making
Updated:
(Nov 9, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...populationChildren/adolescents less than 18 years of ... and/or their caregivers.Intervention(s), exposure...context), participants (i.e., targeted participants, included ages, sociodemographics) and outcomes (all measured outcomes, including...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Shared Decision Making in Pediatrics: A Systematic Review and Meta-analysis.
(Nov, 2015)
Shared Decision Making in Pediatrics: A Systematic Review and Meta-analysis.
(Nov, 2015)
[ 511 ]
PflegeWiki
Updated:
(Oct 4, 2005)
Rate Avg:
(
no ratings
)
(
no ratings
)
...40Jetzt die Zukunft der Pflege aktiv gestalten! AG Junge Pflege veranstaltet den Junge Pflege Kongress...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[One year www.Pflegewiki.de: an encyclopedia which grows with its readers]
(Sep, 2005)
[One year www.Pflegewiki.de: an encyclopedia which grows with its readers]
(Sep, 2005)
[ 512 ]
trial data
Updated:
(Apr 28, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Inclusion criteria1. Pregnant, > 24+0 weeks; 2. ... ≥ 18 years; 3. Informed consent; 4....
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 513 ]
ISRCTN13354298
Updated:
(Jan 16, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...participate? Participants can be of either sex, aged between 16-30 and resident in the...01/2017 Reason abandonedEligibilityParticipant inclusion criteria 1. Aged 16-302. Resident in the London boroughs of Southwark and Lambeth3. Sexually active (at least 1 sexual partner in last 12 months)4. Access to the internet (smart phone, PC or laptop)5. Willing to take an STI test Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 514 ]
Welcome | Epidemiology & Biostatistics
Updated:
(Nov 21, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...PMR)Fellowships & PostdocsKL2 ProgramTraining for Research on Aging and Chronic DiseaseResearchAreas of ConcentrationBioinformaticsBiostatisticsCancer EpidemiologyClinical Epidemiology...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Sequence-based classification using discriminatory motif feature selection.
(2011)
Sequence-based classification using discriminatory motif feature selection.
(2011)
[ 515 ]
Gramene
Updated:
(Apr 4, 2005)
Rate Avg:
(
no ratings
)
(
no ratings
)
...five or more motif repeats, such as ag-5 ('agagagagag').2) Paste/Enter your sequence...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 516 ]
ExomeChip - CHARGE Consortium
Updated:
(Jul 22, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...studies in the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) Consortium consented...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Best Practices and Joint Calling of the HumanExome BeadChip: The CHARGE Consortium.
(2013)
Best Practices and Joint Calling of the HumanExome BeadChip: The CHARGE Consortium.
(2013)
[ 517 ]
Probability and Statistics - Software
Updated:
(Jul 23, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...AddressStatistics & ProbabilityJohann Bernoulli InstituteUniversity of GroningenNijenborgh 99747 AG GroningenThe Netherlands Quick LinksNewsVacancies Statistical softwareR packagesodest...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Borrowing strength: a likelihood ratio test for related sparse signals.
(Aug 1, 2012)
Borrowing strength: a likelihood ratio test for related sparse signals.
(Aug 1, 2012)
[ 518 ]
trial data
Updated:
(Dec 29, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...2. Between 18 and 75 years of ...; 3. Being treated in the outpatient phase...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 519 ]
WebCite query result
Updated:
(Oct 7, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...are between 25 and 70 years of ..., have a regular primary care physician, and...and/or SpanishExclusion Criteria:> 75 years of ... Contacts and Locations Choosing to participate in...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 520 ]
Male Breast Cancer – Be Positive, Be Well
Updated:
(Mar 25, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...name is Herb Wagner and at the ... of 72, I am an 11 year...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 521 ]
ISRCTN - ISRCTN49454276: TREC-SAVE: a trial for aggressive or violent seriously mentally ill people
Updated:
(Aug 11, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Reason abandonedEligibilityParticipant inclusion criteria 1. Anyone (no ... or gender limits) thought to have a...better than the other Participant type Patient ... group Other Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 522 ]
trial data
Updated:
(Feb 26, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...or Problem(s) studiedEating behaviour- Inclusion criteria1. ...: 18-35 years; 2. BMI: 18.5...apparently healthy, unrestrained female volunteers between the ... of 18 and 35 with a normal...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 523 ]
WebCite query result
Updated:
(May 18, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Frame: Up to 12 months of ... ] [ Designated as safety issue: No...Volunteers: YesCriteriaInclusion Criteria:Mother of infant aged 0-4 weeks during the study periodCurrent...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 524 ]
Smart Mobility
Updated:
(Nov 12, 2007)
Rate Avg:
(
no ratings
)
(
no ratings
)
...era of the Internet of Things, the ... of smart applications, will be more than ever the ... of the march of the chips.Discover...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Potential and challenges of body area networks for cardiac monitoring.
(Nov, 2007)
Potential and challenges of body area networks for cardiac monitoring.
(Nov, 2007)
[ 525 ]
downloads.html
Updated:
(Mar 30, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...ApplyMeet UsOur CampusesNewcastle City Centre CampusCampus for Ageing and VitalityNewcastle International Centre for LifeNewcastle University...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Model annotation for synthetic biology: automating model to nucleotide sequence conversion.
(Apr 1, 2011)
Model annotation for synthetic biology: automating model to nucleotide sequence conversion.
(Apr 1, 2011)
[ 526 ]
WebCite query result
Updated:
(Dec 4, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...to listen to other participants; 6. When aged 16-17 years informed consent of both child and parent; when aged 18 and over, informed consent of the...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 527 ]
ISRCTN - ISRCTN92551397: The FAB Study: Feedback, Awareness and Behaviour in the Fenland Study
Updated:
(Sep 25, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...06/2008 Reason abandonedEligibilityParticipant inclusion criteria 1. Aged 30-55 years2. Registered with participating general practices in the Cambridgeshire Primary Care Trust3. Participating in the Fenland Study Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 528 ]
trial data
Updated:
(Oct 7, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...studiedDelirium, Elderly patients, Hip fractures- Inclusion criteria1. ...: 65 years or older; 2. Acute admission...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 529 ]
www.ctalearning.com
Updated:
(Mar 9, 2004)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Dudai Y , 2007See complete record: 3769Effect of ... on methylphenidate-induced conditioned taste avoidance and...Garcia died this past October at the ... of 95 in his home in Skagit...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 530 ]
WebCite query result
Updated:
(Dec 24, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...with liver metastases from neuroendocrine tumours. Patients aged >=18 years. Exclusion criteria: Children or adolescents (under the ... of 18 years). Studies that do not...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 531 ]
Driver Genes | Biostat Wiki
Updated:
(Aug 8, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...RNA-seq and Exome-seq tissue data; ..., altered gene sets; FGS, functional gene set...with a list of altered gene set (...). Each mutated gene is refereed to as functional gene set (FGS) and the ... are derived from the differentially expressed genes and isoforms (Sequgio). A quantitative enrichment z-score is calculated to assess statistical significance of over-represented direct links between ... and FGS; the z-score allows to...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 532 ]
ISRCTN85410458
Updated:
(Dec 3, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...female and at least 4 years of ... at the time of screening3. Patient's diagnosis...to 85% of normal predicted values for ..., sex and height based on Knudson criteria...before visit 2/randomisation) Participant type Patient ... group Mixed Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 533 ]
Det Nationale Forskningscenter for Arbejdsmiljø
Updated:
(Sep 24, 2009)
Rate Avg:
(
no ratings
)
(
no ratings
)
...ways of work in the field of aged care at home, 26.-27.4.2017 NIVA...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 534 ]
2013.V1.FOCUS12330
Updated:
(Jan 3, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...profile was within expected range for her .... An endonasal, fully endoscopic, transplanum transtuberculum approach...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Surgical management of craniopharyngioma with third ventricle involvement.
(Jan, 2013)
Surgical management of craniopharyngioma with third ventricle involvement.
(Jan, 2013)
[ 535 ]
Brainnetome Atlas | Home
Updated:
(Jul 27, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...dynamic changes during normal development and the aging process, or in different disease states.Statistics...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 536 ]
WebCite query result
Updated:
(Dec 24, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...with liver metastases from neuroendocrine tumours. Patients aged >=18 years. Exclusion criteria: Children or adolescents (under the ... of 18 years). Studies that do not...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 537 ]
WebCite query result
Updated:
(Mar 17, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Healthy Volunteers: YesCriteriaInclusion Criteria:Middle school aged child with parent willing to partcipateAbility to partipate in an afterschool programExclusion Criteria:Less or greater than middle school aged Contacts and Locations Choosing to participate in...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 538 ]
Health Information, Resources, Tools & News Online | Everyday Health
Updated:
(Aug 2, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Psoriasis Spring CleaningShareLife With MSBy Trevis Gleason ... at MS Diagnosis Varies by LatitudeShareRemedy ChicksBy...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 539 ]
ISRCTN24529487
Updated:
(Mar 31, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...symptomatically to a diagnosis of major depressionAND3. ... over 18 years and under 65 years, either sex Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 540 ]
Applied Bioinformatics | Molecular Graphics and Modeling Laboratory
Updated:
(Jan 17, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...race, color, ethnicity, religion, sex, national origin, ..., ancestry, disability, status as a veteran, sexual...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 541 ]
WebCite query result
Updated:
(May 19, 2008)
Rate Avg:
(
no ratings
)
(
no ratings
)
...condition, healthy person Participants - inclusion criteria 1. ... 18-65 years 2. No prescribed diet...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 542 ]
addrugdiscovery
Updated:
(Apr 27, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Alzheimer’s disease, related dementias and cognitive aging. The two-day meeting is organized around...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 543 ]
BioMedLib™ search engine: Search the biomedical literature, for the most relevant articles.
Updated:
(Jan 23, 2007)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Gender And for: Male Female + ... And for these ... groups: Newborn: birth to 1 month Infant: 1 to 23 months Preschool child: 2 to 5 years Child: 6 to 12 years Adolescent: 13 to 18 years Adult: 19 to 44 years Middle aged: 45 to 64 years Aged: 65+ years 80 and over: 80+ years...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 544 ]
WHO | The <i>Bulletin</i> series: Health systems financing
Updated:
(Oct 4, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...priceFull Text [HTML]Full Textpdf, 823kbSpectre of ageing population worries economistsFull Text [HTML]Full Text...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 545 ]
ISRCTN59912797
Updated:
(May 11, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Programme or Wellcome Trust. Participant type Patient ... group Other Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Effects of a financial incentive on health researchers' response to an online survey: a randomized controlled trial.
(May 10, 2010)
Effects of a financial incentive on health researchers' response to an online survey: a randomized controlled trial.
(May 10, 2010)
[ 546 ]
ISRCTN19739792
Updated:
(Aug 19, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Participants are adolescents and young adults (typically aged 14-26 years) who are attending vocational...young adults attending vocational or high schools (... 14-26)2. Daily cigarette smoking or occasional cigarette smoking (at least 4 cigarettes in the previous month and at least one cigarette during the past week)3. Ownership of an own mobile phone4. Use of mobile phone text messaging Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 547 ]
WebCite query result
Updated:
(Sep 18, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...via an online access panel (called respondi AG) in Germany. What does the study involve...collection was done in collaboration with respondi AG Cologne. When is the study starting and...member of the online access panel respondi AG Cologne 2. Having Internet access 3. Having...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 548 ]
ISRCTN53643604
Updated:
(Mar 12, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...min5. No comorbid condition Participant type Patient ... group Not Specified Gender Male Target number...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 549 ]
Computational Biochemistry Group (Bayreuth) CoMoDo
Updated:
(Nov 20, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...e-mail: Matthias.Ullmann@uni-bayreuth.de AG Ullmann...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
CoMoDo: Identifying Dynamic Protein Domains Based on Covariances of Motion.
(Jun 9, 2015)
CoMoDo: Identifying Dynamic Protein Domains Based on Covariances of Motion.
(Jun 9, 2015)
[ 550 ]
Shedding Light on Shingles: The Power of Prevention | Elsevier CME
Updated:
(Sep 27, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...VZV). More than 95% of immunocompetent individuals aged at least 50 years are seropositive for VZV and are therefore at risk for developing HZ. ...-related increased incidence of HZ and its...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 551 ]
Overview - Multilingual Children's Speech
Updated:
(May 16, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...functional proficiency or use, regardless of the ... at which the languages were learned" (International...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 552 ]
WebCite query result
Updated:
(Nov 29, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...use/misuse/dependence Participants - inclusion criteria 1. ... between 17 - 65 2. High speed internet...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 553 ]
Homepage | Center for Computational Biology
Updated:
(Jun 30, 2005)
Rate Avg:
(
no ratings
)
(
no ratings
)
...race, color, ethnicity, religion, sex, national origin, ..., ancestry, disability, status as a veteran, sexual...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Development and testing of an automated approach to protein docking.
(Aug 1, 2005)
Development and testing of an automated approach to protein docking.
(Aug 1, 2005)
[ 554 ]
WebCite query result
Updated:
(Mar 27, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...also be photographed and their images digitally aged, as a smoker and non-smoker, using APRIL ... software and invited to view the ...-processed images. (They will receive a copy of their digitally aged photos to keep). All of this will...attitudes are related to personalised smoking photo-ageing pictures, then exposing young smokers (18-30 years old) to their smoking photo aged picture in community pharmacies will result in...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 555 ]
Previser | Oral Risk and Health Analysis
Updated:
(May 14, 2007)
Rate Avg:
(
no ratings
)
(
no ratings
)
...assessment tool tailored for patients under the ... of 17. We look forward to...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Management of periodontal diseases within the NHS three years on: are things any better?
(May 12, 2007)
Management of periodontal diseases within the NHS three years on: are things any better?
(May 12, 2007)
[ 556 ]
WebCite query result
Updated:
(Jan 20, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...criteria 1. 18 to 75 years of ..., either sex 2. Type one or type...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 557 ]
CETL
Updated:
(Jan 29, 2008)
Rate Avg:
(
no ratings
)
(
no ratings
)
...5 juillet 2017 la journée annuelle AG-G2M à l’Institut Imagine (Necker-Paris...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 558 ]
WebCite query result
Updated:
(Jun 19, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Laparoscopic adnex surgery- Inclusion criteria1. Female; 2. ... between 18-65 years; 3. Employed (>8...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 559 ]
ISRCTN - ISRCTN84283190: The Online Parent Information and Support project
Updated:
(Dec 4, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...young people up to 19 years of ... with CKD whose care is managed by...abandonedEligibilityParticipant inclusion criteria Phase 1:1. Children aged (0-19 years)2. Commenced management for...commenced management for CKD Participant type Patient ... group Child Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 560 ]
IBC Journal:: Interdisciplinary Bio Central - Open Access, Open Review Journal
Updated:
(Aug 20, 2009)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Brain Volumes in Youth Decreases in Old ... in Koreans+ Biological computati... Bacterial Logic Devices...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Meeting report: the 2009 Westlake International Conference on Personalized Medicine.
(Aug, 2009)
Meeting report: the 2009 Westlake International Conference on Personalized Medicine.
(Aug, 2009)
[ 561 ]
ROCkeTS Homepage - University of Birmingham
Updated:
(Aug 10, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...for phase 3 prospective studyWe recruit women aged 16-90 presenting to:Outpatient clinics, 2 week urgent referrals, inpatient and emergency referrals to secondary careTarget PopulationPre and Postmenopausal women between the ... of 16 and 90 years with symptoms...Clinical SciencesDentistryGraduate SchoolImmunology and Immunotherapy Inflammation and Ageing MedicineMetabolism and Systems ResearchMicrobiology and InfectionNursingPharmacyCollege of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 562 ]
603
Updated:
(Dec 23, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...intervention. Nine were related to offspring: gestational ... at birth, offspring mortality, birth weight, early...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
A Core Outcome Set for Evaluation of Interventions to Prevent Preterm Birth.
(Jan, 2016)
A Core Outcome Set for Evaluation of Interventions to Prevent Preterm Birth.
(Jan, 2016)
[ 563 ]
ISRCTN - ISRCTN31685626: Positive Online Weight Reduction Study (POWeR)
Updated:
(Mar 30, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...2013 Reason abandonedEligibilityParticipant inclusion criteria 1. Patients aged over 18 years, either gender2. Body mass index (BMI) greater than or equal to 30 (or 28 with hypertension or hypercholesterolaemia) documented in the GP case records Participant type Patient ... group Not Specified Gender Not Specified Target...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 564 ]
index.htm
Updated:
(Sep 3, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...CollectionsLasaLsnSide studiesData RequestsABOUT USStaffLoginCONTACTCOLLABORATIONSSite searchThemesAging research NetherlandsLongitudinal Aging Study AmsterdamAging research and collecting data on aging in the Netherlands The Longitudinal Aging Study Amsterdam (LASA) is a scientific study to determine predictors and consequences of aging. LASA started in 1991 has built up the largest data store on aging in the Netherlands.What do you want...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 565 ]
WebCite query result
Updated:
(Feb 23, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...a chronic respiratory illnessUpdate: Reason:Minimum ...:10 YearsUpdate: Reason:Maximum ...:17 YearsUpdate: Reason:Gender:Both...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 566 ]
The effect of palm oil on blood lipid profile
Updated:
(Jul 3, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...does not set specific restrictions on the ..., gender and health conditions of the study...Participants: details of the participants such as ..., gender, sociodemographic characteristics, inclusion and exclusion criteria...size, study subjects characterization (geographical region, ethnicity, ..., gender, hypercholesterolemic status), exposure characterization (mode of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 567 ]
UNESCO | Building peace in the minds of men and women
Updated:
(Jan 22, 2002)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Day Protecting Journalism Sources in the Digital ... Terrorism and the Media: A Handbook for...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 568 ]
DeltaNet – Chemical and Biological Systems Engineering Laboratory | ETH Zurich
Updated:
(Jul 12, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Group MembersEducation Overview Research Overview Metabolism and Ageing NetworkMitochondria and AgeingNetwork InferenceParameter Estimation and Ensemble...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 569 ]
ISRCTN - ISRCTN98560867: Supporting Parents and Carer's management of Childhood Eczema
Updated:
(Mar 5, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...common, affecting more than 20% of children aged 5 years or younger at some point...abandonedEligibilityParticipant inclusion criteria 1. Carers of children aged 5 years or less2. Those whose children have a diagnosis of eczema on their GP record Participant type Patient ... group Child Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 570 ]
Myocilin.com | Myocilin allele-specific phenotype database | Home
Updated:
(Jan 24, 2008)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Although the prevalence of POAG increases with ..., a subset of patients are diagnosed with...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 571 ]
WebCite query result
Updated:
(Dec 24, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...the detection of potential liver metastases. Patients aged >=18 years. Exclusion criteria: Children or adolescents (under the ... of 18 years). Studies that do not...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 572 ]
Health inequity in access to bariatric surgery: a protocol for a systematic review
Updated:
(Feb 28, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Participants/ populationThe population of interest is adults aged 18 years or older who are obese...socioeconomic status, social capital and plus (ex. ...). Secondary outcomesNone.Data extraction, (selection and coding...sex, religion, education, socioeconomic status, social capital, ..., health insurance status); Patient risk factors (BMI...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Health inequity in access to bariatric surgery: a protocol for a systematic review.
(2014)
Health inequity in access to bariatric surgery: a protocol for a systematic review.
(2014)
[ 573 ]
display_record.asp?ID=CRD42014013730
Updated:
(Jun 11, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...valvular atrial fibrillation or VTE. Patient characteristics: ..., gender, race and ethnicity, risk factors for...industry sponsorship), participant details (number of participants, ..., gender), details of previous tests received, intervention...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 574 ]
ISRCTN53367487
Updated:
(Aug 18, 2009)
Rate Avg:
(
no ratings
)
(
no ratings
)
...American College of Rheumatism Participant type Patient ... group Adult Gender Female Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 575 ]
Inhaler technique in children: a systematic review
Updated:
(Sep 5, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...asthma control, and inhaler technique.Participants/ populationChildren ages 4-18.Intervention(s), exposure(s)To...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 576 ]
ISRCTN39104853
Updated:
(Dec 28, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...2009 Reason abandonedEligibilityParticipant inclusion criteria 1. Minimum ... of 182. Minimum drinking amount of 14 (females) or 21 (males) standard units a week3. Able to read and write in Dutch 4. Given informed consent Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 577 ]
ITTC | The Information and Telecommunication Technology Center
Updated:
(Jul 7, 2005)
Rate Avg:
(
no ratings
)
(
no ratings
)
...race, color, ethnicity, religion, sex, national origin, ..., ancestry, disability, status as a veteran, sexual...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 578 ]
Automated semantic annotation of rare disease cases.
Updated:
(Jun 6, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...case report. The Onset modifier specifies the ... of onset (childhood, adult, etc.), and the...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 579 ]
trace.html
Updated:
(Jun 25, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Group MembersEducation Overview Research Overview Metabolism and Ageing NetworkMitochondria and AgeingNetwork InferenceParameter Estimation and Ensemble...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 580 ]
ISRCTN - ISRCTN49387307: Shortness Of Breath in Lung Cancer
Updated:
(Sep 8, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...1. Primary or secondary malignant lung disease2. Aged over 18 years3. Willingness to engage with...greater than 3 months Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 581 ]
MMTPP - start page
Updated:
(Aug 14, 2002)
Rate Avg:
(
no ratings
)
(
no ratings
)
... Maintenance dietØ ..., sex and dietØ ...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 582 ]
The Molecular Biotechnology Group – The Molecular Biotechnology Group @ IFSC/USP
Updated:
(Jan 28, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Why poor sleep and forgetfulness plague the ageing brain Notable advances 2012 Joint x-ray...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
MolShaCS: A free and open source tool for ligand similarity identification based on Gaussian descriptors.
(Jan, 2013)
MolShaCS: A free and open source tool for ligand similarity identification based on Gaussian descriptors.
(Jan, 2013)
[ 583 ]
CME Information - ACHL Performance Improvement CME Activity
Updated:
(Mar 7, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...issue needs to be addressed as the aging population continues to grow and increasing numbers...AMDA Clinical Practice Guideline American Geriatrics Society (...). Pharmacological management of persistent pain in older...library/pdf/Opioid_Final_Evidence_Report.pdf ... âPain Management GUIDELINES for Older...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 584 ]
Toxcalculator
Updated:
(Mar 26, 2008)
Rate Avg:
(
no ratings
)
(
no ratings
)
...and validated for patients:with aggressive NHL aged between 18 and 60 years with an LDH below the upper normal value and patients between 61 and 75 years of ... irrespective of the LDH valueswith ECOG performance...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Prognostic factors for hematotoxicity of chemotherapy in aggressive non-Hodgkin's lymphoma.
(Apr, 2008)
Prognostic factors for hematotoxicity of chemotherapy in aggressive non-Hodgkin's lymphoma.
(Apr, 2008)
[ 585 ]
S. Joshua Swamidass, MD PhD | computation at the intersection of medicine, biology and chemistry.
Updated:
(May 26, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Comments {{unknown}} Policy, PublicationMarc Rubio and the ...-of-the-Earth QuestionDecember 12, 2015 S....
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Improved Prediction of CYP-Mediated Metabolism with Chemical Fingerprints.
(May 26, 2015)
Improved Prediction of CYP-Mediated Metabolism with Chemical Fingerprints.
(May 26, 2015)
[ 586 ]
WebCite query result
Updated:
(Dec 28, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...-26% of Turkish women 15 years of ... and older are smokers. With lung cancer...Volunteers: YesCriteriaInclusion Criteria:18 years of ... or olderCurrently smoking every dayOwning a TXT...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
A text messaging-based smoking cessation program for adult smokers: randomized controlled trial.
(Dec 27, 2012)
A text messaging-based smoking cessation program for adult smokers: randomized controlled trial.
(Dec 27, 2012)
[ 587 ]
WebCite query result
Updated:
(Jan 26, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...able to provide consentUpdate: Reason:Minimum ...:13 YearsUpdate: Reason:Maximum ...:17 YearsUpdate: Reason:Gender:Both...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 588 ]
WebCite query result
Updated:
(Nov 9, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...YesCriteriaInclusion Criteria:Adult smokers, 18 years of ... or older with Internet accessPregnant women.English speakers able to obtain consentExclusion Criteria:PrisonersAdult unable to consentInfants, Children, Teenagers (those under the ... of 18 years old) Contacts and...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 589 ]
ISRCTN - ISRCTN19781227: Heart Failure in Older People In Care Homes
Updated:
(Jan 8, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...homes in Stockton-on-Tees who are aged 65 years or over, either sex3. Health care professionals, including a representative sample of GPs, HF nurses, and care home staff, involved in care provision will be invited to participate in interviews Participant type Patient ... group Senior Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 590 ]
INDEPTH Network | Better Health Information for Better Health Policy
Updated:
(Dec 22, 2009)
Rate Avg:
(
no ratings
)
(
no ratings
)
...ABACUSAssess, compare community-based...HAALSI Health and Aging in Africa: Longitudinal Studies in three INDEPTH...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 591 ]
Pennington Biomedical Research Center
Updated:
(Mar 4, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...a model that includes the inputs of ..., height, race, gender, weight, and circumferences.Â...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 592 ]
abstract
Updated:
(Jul 7, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...stabilizes p53 via RPL5 and induces cellular senescence. Mol Cell. 2013;50:56â66...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 593 ]
Jiayin's Homepage
Updated:
(Feb 1, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Chen, Rick Wilson, Timothy Ley, Li Ding, ...-related cancer mutations associated with clonal hematopoietic...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
A probabilistic method for identifying rare variants underlying complex traits.
(2013)
A probabilistic method for identifying rare variants underlying complex traits.
(2013)
[ 594 ]
WebCite query result
Updated:
(Jun 29, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...criteriaInclusion CriteriaGender: Both, male and femaleMinimum ...: 18 YearsMaximum ...: no maximum ageend of 1:1...at the discretion of the investigator3. Minimum ... of 18 years4. The patient must be...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 595 ]
ISRCTN27704027
Updated:
(Feb 22, 2017)
Rate Avg:
(
no ratings
)
(
no ratings
)
...12/2013 Reason abandonedEligibilityParticipant inclusion criteria 1. Aged 18 - 65 years, either sex2. Antipsychotic medication 3. Discharged from psychiatric hospital 4. Have mobile phone5. Able to use Finnish language 6. Able to give written informed consent to participate Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 596 ]
schedules
Updated:
(Aug 14, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...schedules by disease covered by antigens within ... range Employment | Other UN Sites | Search | Suggestions...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 597 ]
000444811
Updated:
(Jun 23, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...retinal slippage occurrence.© 2016 S. Karger AG, Basel Author ContactsAhmed ElshewyOphthalmology Department, Faculty of...next Recommend This © 2017 S. Karger AG, Basel Karger International: COM | DE | CNSwitch to...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 598 ]
ISRCTN56326375
Updated:
(Dec 9, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...the past 6 months. There is no ... restriction.What does the study involve?Every...that of other smokers of the same ... and recommendations concerning the smoking behaviour and...least once during past 6 months3. No ... constraints, either gender Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 599 ]
Pregnancy Preparation Drug Survey - Home
Updated:
(Feb 10, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...currently recommends that all women of childbearing ... that are attempting to get pregnant get...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Harms associated with psychoactive substances: findings of the UK National Drug Survey.
(Feb, 2010)
Harms associated with psychoactive substances: findings of the UK National Drug Survey.
(Feb, 2010)
[ 600 ]
home page [Main navigation page for these webpages]
Updated:
(Mar 8, 2000)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Immunology Sex Chromosomes Ageing and PhilosophyBateson pagesLists of Recent Publications, etc...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 601 ]
ISRCTN91956346
Updated:
(Oct 25, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...vs. randomized assessment.Who can participate?Adults aged 21 to 60 with major depressionWhat does...inclusion criteria 1. Both males and females, ... range 21 - 60 years2. Major depression (by...to the treating physician Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 602 ]
Umweltbundesamt: Das Projekt ARCEM
Updated:
(Oct 22, 2004)
Rate Avg:
(
no ratings
)
(
no ratings
)
...mtern aller Landesregierungen, der Ãsterreichischen Kommunalkredit AG im Rahmen des Umweltförderungsgesetzes und dem...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Endocrine disrupters in the aquatic environment: the Austrian approach--ARCEM.
(2004)
Endocrine disrupters in the aquatic environment: the Austrian approach--ARCEM.
(2004)
[ 603 ]
WebCite query result
Updated:
(Mar 30, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...2013 Reason abandonedEligibilityParticipant inclusion criteria 1. Patients aged over 18 years, either gender2. Body mass index (BMI) greater than or equal to 30 (or 28 with hypertension or hypercholesterolaemia) documented in the GP case records Participant type Patient ... group Not Specified Gender Not Specified Target...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 604 ]
NITRC: BrainVisa Morphologist extensions: Tool/Resource Info
Updated:
(Dec 28, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...differences and track morphological changes to study aging, development, neurological and neurodegenerative disorders and genetic...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
A library of cortical morphology analysis tools to study development, aging and genetics of cerebral cortex.
(Jan, 2012)
A library of cortical morphology analysis tools to study development, aging and genetics of cerebral cortex.
(Jan, 2012)
[ 605 ]
WebCite query result
Updated:
(Jul 10, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Control_9 Interventions/Control_10Eligibility Item Value ...-lower limit 35 years-old ...-upper limit 65 years-old > Gender Male...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 606 ]
ISCMR
Updated:
(Oct 29, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...patients with hypothyroidism. In total, 60 patients (... 50.0 ± 9.2 years, 3...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 607 ]
1471-2105-6-168-S4
Updated:
(Aug 25, 2005)
Rate Avg:
(
no ratings
)
(
no ratings
)
...was obtained from the patient and six ...- and sex-matched healthy donors. Peripheral blood...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 608 ]
BIOSCI/Bionet Newsgroups
Updated:
(Sep 24, 1999)
Rate Avg:
(
no ratings
)
(
no ratings
)
...molbio.genbank Subscribe/Post AGEING: Research into cellular and organismal ageing. News: bionet.molbio.ageing Subscribe/Post GENETIC-LINKAGE...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 609 ]
Uterine cancer statistics | Cancer Research UK
Updated:
(Mar 29, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...UK each year are diagnosed in females aged 65 and over (2012-2014). Incidence rates for uterine cancer in the UK are highest in females aged 70-74 (2012-2014).Since the early...the UK each year are in females aged 75 and over (2012-2014). Mortality rates for uterine cancer in the UK are highest in females aged 85-89 (2012-2014).Since the early...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 610 ]
WebCite query result
Updated:
(Dec 24, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...liver metastases and/or healthy parenchyma. Patients aged >=18 years. Exclusion criteria: Children or adolescents (under the ... of 18 years). Studies that do not...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 611 ]
WebCite query result
Updated:
(Apr 15, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Access to PC with internet access 4. Aged 18 years and over, either sex Participants...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 612 ]
ISRCTN - ISRCTN05190231: The CARROT trial: CAllus Reduction Reinforcing Orthotic Therapy
Updated:
(May 27, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...in trial for 18 months 4. Participants aged more than or equal to 16, male and female Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 613 ]
Nobelprize.org
Updated:
(Feb 29, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...and superfluids, passed away on 29 March, ... 88.Biography of Alexei AbrikosovMore about the...trap technique, passed away on 7 March, ... 94.Hans Dehmelt's autobiography1989 Nobel Prize in PhysicsGeorge A. Olah 1927-2017George A. Olah, George A. Olah "for his contribution to carbocation chemistry", passed away on 8 March, ... 89.AutobiographyVideo interview1994 Chemistry Prize ContactE-mail...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Muller's Nobel Prize Lecture: When Ideology Prevailed Over Science.
(Mar, 2012)
[Pathophysiology of the ubiquitn sytstem: overview]
(Aug, 2006)
Muller's Nobel Prize Lecture: When Ideology Prevailed Over Science.
(Mar, 2012)
[Pathophysiology of the ubiquitn sytstem: overview]
(Aug, 2006)
[ 614 ]
ISRCTN05663421
Updated:
(Jan 7, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...individuals.Who can participate?Women and men aged 18 years or more with bipolar affective...bipolar I or bipolar II disorder (F31.-) aged 18 years or more.2. The control group consists of healthy individuals without psychiatric diagnoses3. Sufficient speech intelligibility Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 615 ]
ISRCTN - ISRCTN81375447: Bipolar Interactive PsychoEDucation trial
Updated:
(Nov 6, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...and type II)2. Male and female3. Aged between 18 - 65 years Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 616 ]
SWITCH
Updated:
(May 27, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...juvenile idiopathic arthritis: Who cares after the ... of 16? (published) Objective: Medical follow-up...Juvenile Idiopathic Arthritis: Who cares after the ... of 16? Clinical and Experimental Rheumatology 2010...depth interviews of 11 patients with JIA, aged 18-30 years. Interviews were tape recorded...the patient according to the caregiver (62%), ... (61%), and psychosocial maturity (49%). A transfer...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 617 ]
000327683
Updated:
(May 18, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...cerebral ischemic disease.© 2011 S. Karger AG, BaselArticle / Publication DetailsFirst-Page Preview Published online...previous ArticleRecommend this © 2017 S. Karger AG, Basel Karger International: COM | DE | CNSwitch to...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Cerebral hemodynamic failure presenting as limb-shaking transient ischemic attacks.
(2011)
Cerebral hemodynamic failure presenting as limb-shaking transient ischemic attacks.
(2011)
[ 618 ]
AWMF: Visitenkarte
Updated:
(Sep 24, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...der MukoviszidoseAdrenogenitales Syndrom mit 21-Hydroxylase-Defekt (...), Pränatale TherapieLabordiagnostik schwangerschaftsrelevanter VirusinfektionenHumangenetische Diagnostik...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 619 ]
ISRCTN35692743
Updated:
(Jan 18, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...at least 24 hours Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Non-invasive ventilation (NIV) as an aid to rehabilitation in acute respiratory disease.
(Dec 16, 2011)
Non-invasive ventilation (NIV) as an aid to rehabilitation in acute respiratory disease.
(Dec 16, 2011)
[ 620 ]
WebCite query result
Updated:
(Mar 18, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...nervosa Participants - inclusion criteria Stage One: 1. Aged 16 or above, either sex 2. Based...exclusion criteria Stage One: 1. Under the ... of 16 2. Do not fulfil the...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 621 ]
redemption
Updated:
(Oct 8, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Group MembersEducation Overview Research Overview Metabolism and Ageing NetworkMitochondria and AgeingNetwork InferenceParameter Estimation and Ensemble...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 622 ]
Public Health Europe - European Commission - EU - European Commission
Updated:
(Dec 1, 2008)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Migrants' health Social determinants and health inequalities Ageing Population groups Interest groups Healthy environments Fostering...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 623 ]
trial data
Updated:
(Feb 17, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Sentinel lymph node localization- Inclusion criteria1. Females, aged 18 years or older; 2. Histologically confirmed...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 624 ]
anopheles gambiae gene expression profile @uci
Updated:
(Aug 1, 2006)
Rate Avg:
(
no ratings
)
(
no ratings
)
...hours following a blood meal, and females aged 18 days with or without a bloodmeal...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
angaGEDUCI: Anopheles gambiae gene expression database with integrated comparative algorithms for identifying conserved DNA motifs in promoter sequences.
(May 17, 2006)
Genome-wide analysis of gene expression in adult Anopheles gambiae.
(Feb, 2006)
Microarray analysis of genes showing variable expression following a blood meal in Anopheles gambiae.
(Aug, 2005)
angaGEDUCI: Anopheles gambiae gene expression database with integrated comparative algorithms for identifying conserved DNA motifs in promoter sequences.
(May 17, 2006)
Genome-wide analysis of gene expression in adult Anopheles gambiae.
(Feb, 2006)
Microarray analysis of genes showing variable expression following a blood meal in Anopheles gambiae.
(Aug, 2005)
[ 625 ]
Garmin | United States | Home
Updated:
(Jul 2, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...of our wrist-worn devices for all ages, from activity trackers to smartwatches.Learn More...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 626 ]
ISRCTN23466915
Updated:
(Jun 11, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...06/2014 Reason abandonedEligibilityParticipant inclusion criteria 1. ... 16 years or older 2. Living in...vegetables per day Participant type Healthy volunteer ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 627 ]
WebCite query result
Updated:
(Nov 17, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...criteriaInclusion CriteriaGender: Both, male and femaleMinimum ...: 18 YearsMaximum ...: 90 Yearsend of 1:1...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 628 ]
WebCite query result
Updated:
(Dec 24, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...the presence circulating tumour cells. Patients with ... of >=18 years. Exclusion criteria: Children or adolescents (under the ... of 18 years). Studies that do not...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 629 ]
HCO: Heme Copper Oxygen reductase classification tool
Updated:
(May 11, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Biochem, 2005. 99(1), 194-215. Murzin, A.G., et al., SCOP: a structural classification of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
A bioinformatics classifier and database for heme-copper oxygen reductases.
(2011)
A bioinformatics classifier and database for heme-copper oxygen reductases.
(2011)
[ 630 ]
WebCite query result
Updated:
(Aug 26, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...the portal. For children 13 years of ... and older, both parents and adolescents received...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 631 ]
ISRCTN - ISRCTN82153174: Invasive versus Conservative Treatment in Unstable coronary Syndromes
Updated:
(Dec 26, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...a positive exercise test Participant type Patient ... group Adult Gender Both Target number of participants 1200 Participant exclusion criteria 1. ... younger than 18 years or older than...Tijssen JG, de Winter RJ, Effects of ... on long-term outcomes after a routine...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 632 ]
WebCite query result
Updated:
(Dec 9, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...the past 6 months. There is no ... restriction.What does the study involve?Every...that of other smokers of the same ... and recommendations concerning the smoking behaviour and...least once during past 6 months3. No ... constraints, either gender Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 633 ]
WebCite query result
Updated:
(Dec 22, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...of fallsAccess to InternetUpdate: Reason:Minimum ...: No limitUpdate: Reason:Maximum ...: No limitUpdate: Reason:Gender:Both...4:Individual Name:Jane Sims Address:Healthy Ageing Research UnitNotting Hill CampusMonash UniversityNotting Hill, Victoria3168...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 634 ]
DATASETS: "Abril et al, Genome Research, 15(1):111-119, 2005."
Updated:
(Jan 5, 2005)
Rate Avg:
(
no ratings
)
(
no ratings
)
...of switching between AT-AC and GT-AG subtypes within U12 introns, suggesting that this event has been a rare occurrence in recent evolutionary times. Switching between GT-AG and the non-canonical GC-AG U2 subtypes, on the contrary, does not...to be relatively well tolerated in GT-AG introns with very strong donor sites. UCSC...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 635 ]
ISRCTN61819220
Updated:
(Dec 20, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...duration of the study Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 636 ]
WebCite query result
Updated:
(Apr 3, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...of fallsAccess to InternetUpdate: Reason:Minimum ...: No limitUpdate: Reason:Maximum ...: No limitUpdate: Reason:Gender:Both...4:Individual Name:Jane Sims Address:Healthy Ageing Research UnitNotting Hill CampusMonash UniversityNotting Hill, Victoria3168...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 637 ]
Home > Screening Brief Intervention & Referral to Treatment | Yale School of Medicine
Updated:
(Jun 13, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...the 23.6 million people over the ... of 12 in the U.S. who need...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Care for hospitalized patients with unhealthy alcohol use: a narrative review.
(2013)
Care for hospitalized patients with unhealthy alcohol use: a narrative review.
(2013)
[ 638 ]
ISRCTN - ISRCTN18649610: The Men's Safer Sex (MenSS) Trial: a website to increase condom use
Updated:
(Feb 17, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Who can participate?We will recruit men, aged 18 years and over who are at...2015 Reason abandonedEligibilityParticipant inclusion criteria 1. Male2. Aged 18 years and over (with no upper ... limit) 3. Able to read English4. Heterosexual...and female partners Participant type Healthy volunteer ... group Adult Gender Male Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 639 ]
WebCite query result
Updated:
(Nov 6, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...and type II)2. Male and female3. Aged between 18 - 65 years Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 640 ]
Nanomaterial effects on C. elegans
Updated:
(Feb 17, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
... nano-Ag ...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 641 ]
WebCite query result
Updated:
(Jun 11, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...06/2014 Reason abandonedEligibilityParticipant inclusion criteria 1. ... 16 years or older 2. Living in...vegetables per day Participant type Healthy volunteer ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 642 ]
Theoretical Biology and Medical Modelling | Home page
Updated:
(Jan 16, 2008)
Rate Avg:
(
no ratings
)
(
no ratings
)
...the emergence of novel concepts in an ... of systems biology, bioinformatics and computer modelling...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 643 ]
iSHARE Repository
Updated:
(Aug 3, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...More...Latest additions South Africa - Health and Aging in Africa: A Longitudinal Study of an...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 644 ]
NHS Direct legacy enquiries - Contact - NHS Choices
Updated:
(Oct 10, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...news reportsMedical practice news reportsOlder people and ageing news reportsGenetics and stem cells news reportsMental...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 645 ]
The Kilby International Awards Foundation
Updated:
(Jul 23, 2002)
Rate Avg:
(
no ratings
)
(
no ratings
)
...the slopes of Mt. Kilimanjaro, at the ... of 20, he was selected as the...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Multipin peptide libraries for antibody and receptor epitope screening and characterization.
(Sep 1, 2002)
Multipin peptide libraries for antibody and receptor epitope screening and characterization.
(Sep 1, 2002)
[ 646 ]
Genome Biology | Home page
Updated:
(Dec 12, 2005)
Rate Avg:
(
no ratings
)
(
no ratings
)
...T ElderPublished on: 30 January 2015ResearchDNA methylation ... of human tissues and cell typesSteve HorvathPublished...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Drosophila melanogaster: a case study of a model genomic sequence and its consequences.
(Dec, 2005)
[Bioinformatics of evolution of metabolic system]
(Nov, 2003)
Drosophila melanogaster: a case study of a model genomic sequence and its consequences.
(Dec, 2005)
[Bioinformatics of evolution of metabolic system]
(Nov, 2003)
[ 647 ]
OPA1 homepage - MITOchondrial DYNamics variation pages - Leiden Open Variation Database
Updated:
(Jan 5, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...eyes asynchronously and appears at a later ... (18-35 yrs), although in atrophic phase...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Improved locus-specific database for OPA1 mutations allows inclusion of advanced clinical data.
(Jan, 2015)
eOPA1: an online database for OPA1 mutations.
(May, 2005)
Improved locus-specific database for OPA1 mutations allows inclusion of advanced clinical data.
(Jan, 2015)
eOPA1: an online database for OPA1 mutations.
(May, 2005)
[ 648 ]
Journal of Speech, Language, and Hearing Research | ASHA Publications
Updated:
(Apr 2, 2009)
Rate Avg:
(
no ratings
)
(
no ratings
)
...of Chemesthenic Stimuli on Swallowing Parameters Given ... and Genetic Taste Differences in Healthy Adult...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Adult and child semantic neighbors of the Kroll and Potter (1984) nonobjects.
(Apr, 2009)
Adult and child semantic neighbors of the Kroll and Potter (1984) nonobjects.
(Apr, 2009)
[ 649 ]
WebCite query result
Updated:
(Jun 9, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...5. Target Gender: Male & Female 6. Lower ... Limit 18 years Participant type Patient ... group Adult Gender Both Target number of...presence of a doctor3. Being under the ... of 184. Having active suicidal thoughts Recruitment...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 650 ]
WebCite query result
Updated:
(Jan 7, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...individuals.Who can participate?Women and men aged 18 years or more with bipolar affective...bipolar I or bipolar II disorder (F31.-) aged 18 years or more.2. The control group consists of healthy individuals without psychiatric diagnoses3. Sufficient speech intelligibility Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 651 ]
WebCite query result
Updated:
(Jun 18, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...or Problem(s) studiedEating disorders- Inclusion criteria1. Aged 16 years or older; 2. At least...cost-effectiveness of Featback. Study design: Individuals aged 16 years or older , with mild to...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 652 ]
WebCite query result
Updated:
(Mar 24, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Interview (CIDI). Eligibility Key inclusion criteria(1) ... of 18-25 years; (2) Current depressive...Internet-based intervention specifically designed for people aged 18 to 25 years with depression and co-occurring problematic alcohol use. This will be the first RCT of an Internet-delivered treatment for comorbid depression and problematic alcohol use in any ... group.Trial websitewww.dealproject.org.auTrial related...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 653 ]
WebCite query result
Updated:
(Aug 22, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...significantly lower body weight and at younger ages compared to people of European origin. The...Bangladesh and Sri Lanka) ≥ 30 years ... will be eligible for SAHARA. Subjects with...risk factors and MI at a younger ... compared to people of European origin. The...than or equal to 30 years of ...;No previous cardiovascular diseaseExclusion Criteria:Not residents...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 654 ]
OHTN Cohort Study | The Ontario HIV Treatment Network
Updated:
(Apr 9, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...HIV including men and women of different ages, sexual orientations and ethnicities.A 2015 study...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Cohort profile: the Ontario HIV Treatment Network Cohort Study (OCS).
(Apr, 2013)
Cohort profile: the Ontario HIV Treatment Network Cohort Study (OCS).
(Apr, 2013)
[ 655 ]
ISRCTN - ISRCTN21800480: Acute medical unit comprehensive geriatric assessment intervention study
Updated:
(May 6, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...ORCID IDContact details Division of Rehabilitation and Ageing Medical School Queens Medical Centre Derby Road...do this by recruiting approximately 600 patients aged 70 years or over attending and discharged...Centre, Nottingham or Leicester Royal Infirmary, Leicester2. Aged 70 years or over, either sex3. Identified...to the patient participant. Participant type Patient ... group Senior Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 656 ]
ISRCTN45369145
Updated:
(Jun 9, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Who can participate? Households with a child aged 1-6 living in hamlets in the...surveys were completed among 3164 mothers with ... eligible children living in 160 village hamlets...derive childrenâs length/height-for-..., weight-for-..., weight-for-length/height, and body mass index (BMI)-for-... using the World Health Organization Child Growth...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 657 ]
Long-term evaluation of postmastectomy breast reconstruction: Acta Oncologica: Vol 50, No 7
Updated:
(Sep 14, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...median of seven years, neither the patient's ... nor the length of time since the...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 658 ]
DRKS - Deutsches Register Klinischer Studien (German Clinical Trials Register)
Updated:
(Apr 19, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...are included, matched by gender, education and ....end of 1:1-Block public summarystart...are included, matched by gender, education and ....end of 1:1-Block scientific synopsisstart...criteriaInclusion CriteriaGender: Both, male and femaleMinimum ...: 18 YearsMaximum ...: 65 Yearsend of 1:1...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 659 ]
WebCite query result
Updated:
(Apr 12, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...there any country specific difference observable? 4. ... effects: to what extent does an ...-specific difference in the effectiveness of the intervention transpire?- Healt Condition(s) or Problem(s) studiedCardiovascular disease, Fruit consumption, Vegetable consumption, Physical activity- Inclusion criteria1. People aged 45-85 years; 2. People have Internet...be considered are demographic variables, stage, SES, ..., gender, depression, family status, nationality and diseases...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 660 ]
R/qtl software for mapping quantitative trait loci
Updated:
(Dec 20, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...the presence of covariates (such as sex, ... or treatment). One may also fit higher...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
WormQTL--public archive and analysis web portal for natural variation data in Caenorhabditis spp.
(Jan, 2013)
WormQTL--public archive and analysis web portal for natural variation data in Caenorhabditis spp.
(Jan, 2013)
[ 661 ]
ISRCTN16823487
Updated:
(Dec 20, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Depression scale (CES-D). Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 662 ]
Welcome to the Jeffery Lab
Updated:
(Dec 31, 2002)
Rate Avg:
(
no ratings
)
(
no ratings
)
...of tissue replacement and regenerative potential during aging. The latter studies are being carried out...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 663 ]
ISRCTN17057980
Updated:
(Aug 12, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...community acquired pneumonia (CAP) Participant type Patient ... group Child Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 664 ]
WebCite query result
Updated:
(Mar 31, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...a diagnosis of major depression AND 3. ... over 18 years and under 65 years...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 665 ]
ISRCTN - ISRCTN98441241: The Relaxation Exercise and Social Support Trial
Updated:
(Jan 1, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...vaginal discharge among low-income married women, aged 18 - 49 years and residing in Hay...measures/cofactors included:3. Socio-demographic factors: ..., education, employment status, family composition (presence of extended family members), number of children present (by ... of each child), housing tenure (owned or...exclusion criteria listed below Participant type Patient ... group Adult Gender Female Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 666 ]
Think Ahead - Irish Hospice Foundation
Updated:
(May 11, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...people from all walks of life, all ages and all levels of health across the...people from all walks of life, all ages and all levels of […] Read more > Fill...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 667 ]
WebCite query result
Updated:
(Apr 9, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...physical condition.Participants/ populationChildren or young people aged 10-24 years old (WHO definition).Intervention...Moreover the population will likely be different ... groups living with various physical long-term...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 668 ]
ISRCTN - ISRCTN74848736: Danish Alzheimer Intervention StudY
Updated:
(Nov 25, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Diagnosed within 12 months prior to inclusion4. Aged above 50 years5. Mild dementia: Mini-Mental...from patient and caregiver Participant type Patient ... group Senior Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 669 ]
j.eururo.2012.05.023
Updated:
(Sep 3, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...BPS/IC patients (n = 193) and ...-matched controls (n = 115). Scales included...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 670 ]
International Research | Curry International Tuberculosis Center
Updated:
(Mar 28, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...high-quality care for patients of all ages. Edition 1 of the Standards was released...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 671 ]
Alcohol Research UK – Informing Policy and Practice
Updated:
(Mar 4, 2004)
Rate Avg:
(
no ratings
)
(
no ratings
)
...a Birmingham-based alcohol service for people aged 50 years and older. It is one...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 672 ]
Tardigrade Analyzer
Updated:
(Oct 28, 2009)
Rate Avg:
(
no ratings
)
(
no ratings
)
...is 500. Updated: 10-Apr-2009 Dandekar AG, Biozentrum, WuerzburgBeside the arguments above, other parameters...for generating appropriate reports.Copyright by Dandekar AG, Bioinformatics, Biozentrum of Uni. Wuerzburg, Am Hubland Powered by Dandekar AG RSS Imprint Admin Register Logout...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 673 ]
19648
Updated:
(Feb 12, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Molecules EISSN 1420-3049 Published by MDPI AG, Basel, Switzerland RSS E-Mail Table of...ScienceVaccinesVeterinary SciencesVirusesVisionWater Subscribe © 1996-2017 MDPI AG (Basel, Switzerland) unless otherwise stated Back to
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 674 ]
Wireless Technology - News & Views - Association for the Advancement of Medical Instrumentation
Updated:
(May 22, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...June 2011Wireless Technology: Leading to a New ... of Medicine, BI&T, March/April, 2011FCCFDA...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 675 ]
ISRCTN - ISRCTN25619675: A fully automated and web-based intervention for stress management
Updated:
(Apr 23, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...levels of stress are not moderated by ..., gender or educational levels. Ethics approval Norwegian...and be >= 18 years Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 676 ]
EuroLupus
Updated:
(Oct 15, 2007)
Rate Avg:
(
no ratings
)
(
no ratings
)
...clinical spectrum of APS related to the ... at onset of the disease [reviewed in...inclusion into the register), disease related data (... at the onset of APS, clinical manifestations...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 677 ]
WebCite query result
Updated:
(Aug 19, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Participants are adolescents and young adults (typically aged 14-26 years) who are attending vocational...young adults attending vocational or high schools (... 14-26) 2. Daily cigarette smoking or...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 678 ]
Bioinformatics - WUR
Updated:
(Sep 2, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...-0836 - p. 307 - 312. Fusarium in the ... of genomics Waalwijk, C. , Vanheule, Adriaan , Audenaert...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 679 ]
Wolfgang Otto
Updated:
(Mar 24, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...variance of the binding site numbers, the ages of clades, the variance/mean ratio. the...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 680 ]
Sex and severe sepsis | Critical Care | Full Text
Updated:
(Aug 5, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...be explained by confounding factors such as ..., nosocomial infections, follow-up period, and case...patients were younger than 50 years of .... The median length of stay was short...in the study by Sakr and colleagues, ... might have contributed to the higher mortality...Mannino DM, Moss M: The effect of ... on the development and outcome of adult sepsis. Crit Care Med 2006, 34: 15-21. 10.1097/01.CCM.0000194535.82812.BAView ArticlePubMedGoogle ScholarGomez RC, Boehmer DE, Kovacs JE: The aging innate immune system. Curr Opin Immunol 2005...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
The influence of gender on the epidemiology of and outcome from severe sepsis.
(2013)
The influence of gender on the epidemiology of and outcome from severe sepsis.
(2013)
[ 681 ]
1471-2105-8-174-S10
Updated:
(Jul 2, 2007)
Rate Avg:
(
no ratings
)
(
no ratings
)
...BarH-like 1 homeobox protein. ENSG00000130283 LASS1 10715 LAG1 longevity assurance homolog 1 (UOG-1 protein) (LAG1 protein). ENSG00000130643...like 1 homeobox protein. 13. ENSG00000130283 LASS1 10715 LAG1 longevity assurance homolog 1 (UOG-1 protein) (LAG1 protein). 14...BarH-like 1 homeobox protein. ENSG00000130283 LASS1 10715 LAG1 longevity assurance homolog 1 (UOG-1 protein) (LAG1 protein). ENSG00000182087...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 682 ]
WebCite query result
Updated:
(Dec 24, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Exclusion criteria: Children or adolescents (under the ... of 18 years). Studies that don't report...treatment group, type of non-surgical-treatment, ..., male:female ratio, progression free survival, overall...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 683 ]
WebCite query result
Updated:
(Jun 7, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...or addiction Participants - inclusion criteria 1. Minimum ... of 18 years 2. Alcohol Use Disorder...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 684 ]
ISRCTN79864465
Updated:
(Sep 13, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...persistent to moderate asthma (prevalent cases)2. ... 18-50 years3. Doctor's diagnosis of asthma4. Asthma severity step 2-3, patients who need inhaled corticosteroids as controller medication (at least 3 months in the past year)5. PC with internet connection available6. Able to communicate in the Dutch language Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 685 ]
ISRCTN66772711
Updated:
(Apr 2, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...can participate? Villagers, over 40 years of ..., who have lived in the selected villages...as priority intervention group Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 686 ]
WebCite query result
Updated:
(Jun 26, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Volunteers: NoCriteriaInclusion Criteria:Be between the ages of 18-30 years old or 31...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 687 ]
ISRCTN57754429
Updated:
(Aug 14, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...University Medical Centre (VUMC) in Amsterdam, Netherlands2. Aged 18 years and older3. Proficiency in Dutch Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 688 ]
trial data
Updated:
(Dec 16, 2008)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Depression Rating Scale (HDRS-17) >18; 3. ... 18 to 70 years; 4. Maximally 1...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 689 ]
Medical Research & Clinical Trials: El Paso, TX: Western Sky Medical Research
Updated:
(Jan 11, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...related studies. If you are an adult (ages 40 and older) with smoking history, either...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 690 ]
ISRCTN45178534
Updated:
(Jul 11, 2007)
Rate Avg:
(
no ratings
)
(
no ratings
)
...conditions than Fabry disease Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Treatment of Fabry disease: outcome of a comparative trial with agalsidase alfa or beta at a dose of 0.2 mg/kg.
(Jul 11, 2007)
Treatment of Fabry disease: outcome of a comparative trial with agalsidase alfa or beta at a dose of 0.2 mg/kg.
(Jul 11, 2007)
[ 691 ]
jcb.201505037
Updated:
(Nov 24, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...used, Numb controls asymmetric self-renewal and lifespan of PKHhigh cells, thus safeguarding against their...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Regulating the regulator: Numb acts upstream of p53 to control mammary stem and progenitor cell.
(Nov 23, 2015)
Regulating the regulator: Numb acts upstream of p53 to control mammary stem and progenitor cell.
(Nov 23, 2015)
[ 692 ]
full
Updated:
(Jan 23, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Neuroanat.42: 225-35 [PMID:21382474]Engel AG et al. (2015) Congenital myasthenic syndromes: pathogenesis...cell stress responses, including apoptosis, autophagy and senescence, Serine palmitoyltransferase generates 3-ketosphinganine, which is...heritable phenomena such as X chromosome inactivation, aging, heterochromatin formation, reprogramming, and gene silencing (epigenetic...JA et al. (2015) Molecular aspects of ...-related cognitive decline: the role of GABA...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 693 ]
WebCite query result
Updated:
(Nov 26, 2008)
Rate Avg:
(
no ratings
)
(
no ratings
)
...were between 18 and 65 years of ..., had a weekly alcohol consumption of more...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 694 ]
EnchyBASE
Updated:
(May 4, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Silver has antimicrobial properties and silver nanoparticles (Ag-NPs) have been some of the most widely used NPs. Information regarding their effects is still insufficient, in particular for soil dwelling organisms. The standard soil Oligochaete Enchytraeus albidus was used to study the effects of Ag in soils, using differential gene expression (microarray...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Enchytraeus albidus Microarray: Enrichment, Design, Annotation and Database (EnchyBASE).
(2012)
Enchytraeus albidus Microarray: Enrichment, Design, Annotation and Database (EnchyBASE).
(2012)
[ 695 ]
ISRCTN - ISRCTN49197425: The Warwick Hip Trauma Study
Updated:
(Jun 26, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...the proximal femur2. Male and female, lower ... limit of 65 years3. With or without capacity to consent Participant type Patient ... group Senior Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 696 ]
EHMA - European Health Management Association
Updated:
(Jun 18, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...family #caregiver main challenge to #integratedcare says @..._PlatformEU bit.ly/sustainAGE pic.twitter.com...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 697 ]
ISRCTN - ISRCTN05891695: Testing the efficacy of an early intervention for acute insomnia
Updated:
(Jun 6, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...who are at least 18 years of ... and have acute insomnia.What does the...of the poor sleep. Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 698 ]
WHO | Sexual and reproductive health
Updated:
(May 30, 2005)
Rate Avg:
(
no ratings
)
(
no ratings
)
...were an estimated 17.8 million women aged 15 and older living with HIV in...was to some extent influenced by maternal ..., height, weight, parity and by fetal sex...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 699 ]
ISRCTN - ISRCTN13704604: The Bullous Pemphigoid Steroids and Tetracyclines Study
Updated:
(Aug 21, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...reduction in effectiveness.Who can participate? Patients aged 18 or over with bullous pemphigoidWhat does...inclusion criteria 1. Both males and females, aged at least 18 years old2. Able to...at least one year Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 700 ]
echo.13186
Updated:
(Jul 4, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...compared them to 198 controls matched for ..., gender, body mass index, and prevalence of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 701 ]
ISRCTN72466475
Updated:
(Jul 6, 2007)
Rate Avg:
(
no ratings
)
(
no ratings
)
...taking adequate contraceptive precautions Participant type Patient ... group Not Specified Gender Both Target number...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 702 ]
WebCite query result
Updated:
(Sep 8, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...criteriaInclusion CriteriaGender: Both, male and femaleMinimum ...: 18 YearsMaximum ...: no maximum ageend of 1:1...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 703 ]
ISRCTN96595458
Updated:
(Aug 18, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...NAILED ACS risk factor trial (Nurse based, ... independent Intervention to Limit Evolution of Disease...week) are self reported. Subanalyses according to ... and gender are planned. Overall trial start...to communicate by telephone Participant type Patient ... group Adult Gender Both Target number of...mvall A, Ulvenstam A, The Nurse-Based ... Independent Intervention to Limit Evolution of Disease...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 704 ]
WebCite query result
Updated:
(Jul 29, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...in Young AdultsParticipants/ populationPopulation: Healthy young adults aged 18-30 years with no disease or...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 705 ]
18381
Updated:
(Feb 12, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Molecules EISSN 1420-3049 Published by MDPI AG, Basel, Switzerland RSS E-Mail Table of...ScienceVaccinesVeterinary SciencesVirusesVisionWater Subscribe © 1996-2017 MDPI AG (Basel, Switzerland) unless otherwise stated Back to
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 706 ]
ISRCTN76742797
Updated:
(Nov 8, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...screening if they:1. Have reached the ... of consent in their country for participating...give written informed consent Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 707 ]
Accueil
Updated:
(Apr 29, 2009)
Rate Avg:
(
no ratings
)
(
no ratings
)
...dans le monde entier. Il sâ... Lire la suite... décembre 2016 Voeux...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 708 ]
WebCite query result
Updated:
(Dec 4, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...young people up to 19 years of ... with CKD whose care is managed by...Participants - inclusion criteria Phase 1: 1. Children aged (0-19 years) 2. Commenced management for...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 709 ]
Chemical safety and biosafety - OECD
Updated:
(Aug 11, 2003)
Rate Avg:
(
no ratings
)
(
no ratings
)
...to Testing and Assessment 22 March 2017 Ageing of hazardous installations 20 March 2017 The...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
OECD environment, health and safety programme: information on the world wide web.
(Aug 21, 2003)
OECD environment, health and safety programme: information on the world wide web.
(Aug 21, 2003)
[ 710 ]
ISRCTN22085282
Updated:
(Mar 15, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...available will be included. Participant type Patient ... group Not Specified Gender Not Specified Target...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Quality and safety of care provided by emergency care practitioners.
(Apr, 2012)
Quality and safety of care provided by emergency care practitioners.
(Apr, 2012)
[ 711 ]
Antioxidants & Redox Signaling
Updated:
(Jan 5, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...ultimately contribute to slowing or reversing the aging process.More InfoOnline AccessBrowse All Publications »Resources...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 712 ]
ISRCTN - ISRCTN03704676: Internet Delivered Treatment for symptoms of Depression in the community
Updated:
(Dec 24, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Irish adult community.Who can participate?Subjects aged 18-65 years with symptoms of depression...displaying high rates of lifetime incidence, early ... onset, high chronicity, and role impairment. In...criteria 1. At least 18 years of ..., either sex2. Mild to Moderate depressive symptoms (BDI-II 14-29 range) Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 713 ]
ISRCTN69603913
Updated:
(May 14, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...they are currently under 18 years of ... or are currently receiving treatment for depression by a mental health specialist. Both people with and without depressive symptoms can participate in this trial, as the intervention aims to prevent depression as well as to treat the condition. Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 714 ]
ISRCTN65657330
Updated:
(Jan 9, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...group for depression.Who can participate? People aged between 18 and 65 with evidence of psychological distress, determined through a screening questionnaireWhat does the study involve? The study involves two separate stages. First there is a survey of people aged between 18 and 65 to find out...03/2010 Reason abandonedEligibilityParticipant inclusion criteria 1. Aged 18 - 65 years, either sex2. Evidence of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 715 ]
WebCite query result
Updated:
(Feb 25, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...at least three of the following six: ... > 50 years, morning stiffness ...of the hip ¡Ü 60 minutes and ... > 50 years 2) Not meeting the recommendations of the Dutch Norm for Health-enhancing Physical Activity (30 minutes or more of at least moderate-intensity aerobic physical activity on at least five days each week) 3) ... between 40 and 80 years 4) No...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 716 ]
Table of Contents | Clinical Chemistry
Updated:
(Jul 27, 2000)
Rate Avg:
(
no ratings
)
(
no ratings
)
...accessImmunoradiometric Assay of Circulating C-Reactive Protein: ...-related Values in the Adult General PopulationWinston...Concentrations in Cord Blood: Correlations with Gestational ... in Term and Preterm Deliveries,Diego Gazzolo...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Toward a checklist for reporting of studies of diagnostic accuracy of medical tests.
(Jul, 2000)
Toward a checklist for reporting of studies of diagnostic accuracy of medical tests.
(Jul, 2000)
[ 717 ]
Has evidence changed practice?
Updated:
(Feb 21, 2008)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Among the 9,588 patients, the mean ... was 74.6 years and 93.6...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 718 ]
ISRCTN66626762
Updated:
(Mar 12, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Reason abandonedEligibilityParticipant inclusion criteria 1. Male patients aged 18+ years, Eastern Cooperative Oncology Group (ECOG...of any study procedure Participant type Patient ... group Adult Gender Male Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 719 ]
Accueil | SFCE
Updated:
(Jul 11, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...de pointe, y compris le séquenç... de haut débit. Des modifications de...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 720 ]
DRKS - Deutsches Register Klinischer Studien (German Clinical Trials Register)
Updated:
(Dec 16, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...patients with the confirmed diagnosis of vasculopathy aged 18-80 years.end of 1:1...criteriaInclusion CriteriaGender: Both, male and femaleMinimum ...: 18 YearsMaximum ...: 80 Yearsend of 1:1-Block inclusion criteriastart of 1:1-Block inclusion criteria addAdditional Inclusion Criteria1. Secured diagnosis of livedoid vasculopathy2. ... ≥ 18 ...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 721 ]
ISRCTN77607163
Updated:
(Feb 13, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...a lower molar tooth. Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 722 ]
WebCite query result
Updated:
(Jun 2, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...evaluate the effect of two interventions at ... 15/16 years (fourth grade) compared with...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 723 ]
WebCite query result
Updated:
(Jan 7, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...evaluate the effect of two interventions at ... 15/16 years (fourth grade) compared with...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 724 ]
AMADEUS: O projektu Amadeus
Updated:
(Dec 7, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...analytické reporty z registru AMADEuS.ArchivProjekt AMADEuS (... related MAcular DEgeneration And MAcular Diabetic Edema...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 725 ]
WebCite query result
Updated:
(Jun 28, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...national telephone counselling service who: 1. Are aged 18 years or older, both men and...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 726 ]
LONGSCAN: Consortium for Longitudinal Studies of Child Abuse and Neglect
Updated:
(Feb 4, 2009)
Rate Avg:
(
no ratings
)
(
no ratings
)
...teachers are scheduled to occur at child ages 4, 6, 8, 12, 14, 16, and...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 727 ]
WebCite query result
Updated:
(Mar 3, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...BothAccepts Healthy Volunteers: YesCriteriaInclusion Criteria:People aged more than 18 yearsWeb and e-mail...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 728 ]
ISRCTN - ISRCTN74033088: Randomised controlled trial of physical therapy in ankle sprains
Updated:
(Nov 17, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Kingston, Ontario, within 48 hours of injury2. Aged 16 years and older, both sexes3. Mentally...follow-up telephone calls Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 729 ]
WebCite query result
Updated:
(Sep 21, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...intensive care unit patientsCriteriaInclusion Criteria:Adult patients (... > 18 years)Spontaneously breathing (i.e. no...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 730 ]
WebCite query result
Updated:
(Sep 13, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...inclusion criteria 1. Patients anticipated to be aged from 45 to 70 years, either sex...patients varying in demographic variables such as ..., ethnic background and gender. These interviews will...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
A web-based program improves physical activity outcomes in a primary care angina population: randomized controlled trial.
(Sep 12, 2014)
A web-based program improves physical activity outcomes in a primary care angina population: randomized controlled trial.
(Sep 12, 2014)
[ 731 ]
Welcome to the ACEAS
Updated:
(Aug 31, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...and other synthesis centre groups of similar ... submitted articles. The SI was published, with...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Transdisciplinary synthesis for ecosystem science, policy and management: The Australian experience.
(Nov 15, 2015)
Transdisciplinary synthesis for ecosystem science, policy and management: The Australian experience.
(Nov 15, 2015)
[ 732 ]
DRKS - Deutsches Register Klinischer Studien (German Clinical Trials Register)
Updated:
(Aug 21, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...criteriaInclusion CriteriaGender: Both, male and femaleMinimum ...: 20 YearsMaximum ...: 35 Yearsend of 1:1...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 733 ]
WebCite query result
Updated:
(Feb 5, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...to evaluate the intervention among excessive drinkers aged 18 and older.- Exclusion criteria1. Respondents that...person (a typical drinker of your ...), with identifiable, distinct characteristics (e.g., ...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 734 ]
WebCite query result
Updated:
(Apr 9, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...in Young AdultsParticipants/ populationPopulation: Healthy young adults aged 18-30 years with no disease or...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 735 ]
WebCite query result
Updated:
(Oct 14, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...of life, Somatic symptoms, Acculturation- Inclusion criteria1. Aged 18 years or older; 2. Depressive symptoms...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 736 ]
First Cambodian case of avian flu confirmed | CIDRAP
Updated:
(Mar 15, 2005)
Rate Avg:
(
no ratings
)
(
no ratings
)
...count does not include two Vietnamese girls, aged 13 and 10, who died Jan 29...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 737 ]
CITATIONS
Updated:
(Jun 25, 2003)
Rate Avg:
(
no ratings
)
(
no ratings
)
...YG_S98 Yeast_2 Ecoli Pae_G1a AG Barley1 Other Select Organism Homo sapiens Arabidopsis...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 738 ]
trypanocyc
Updated:
(Jan 16, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Franco F, Smith TK, Taylor MC, Tielens AG, Urbaniak MD, van Hellemond JJ, Vincent IM...Franco F, Smith TK, Taylor MC, Tielens AG, Urbaniak MD, van Hellemond JJ, Vincent IM...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 739 ]
WebCite query result
Updated:
(Jun 19, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...studiedEating disorders- Inclusion criteria1. Female; 2. Minimum ... of 18; 3. Diagnosis bulimia nervosa (BN...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 740 ]
Cosmetic Care UK
Updated:
(Dec 10, 1998)
Rate Avg:
(
no ratings
)
(
no ratings
)
...confusing for men in this day and ... when it comes to how to impress...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Clarifying the UKCC's position in relation to higher level practice.
(Sep 10, 1998)
Clarifying the UKCC's position in relation to higher level practice.
(Sep 10, 1998)
[ 741 ]
trial data
Updated:
(Nov 15, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...not differ for participants with different characteristics (..., gender, and cultural background); 4. The effect...economical status (SES), Social isolation- Inclusion criteria1. ...: >=18 years; 2. Social isolation: A score...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 742 ]
ISRCTN - ISRCTN59948178: Internet Program for the Reduction of Cannabis Use
Updated:
(Oct 14, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Control program. Who can participate? Cannabis users aged 18 and above, either sex, and who...2015 Reason abandonedEligibilityParticipant inclusion criteria 1. Minimal ... 18, either sex2. At least once a week cannabis use in the past 30 days prior to study entry Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 743 ]
Antiplatelet therapy: a double-edged sword in head injury? | Critical Care | Full Text
Updated:
(Aug 5, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...of cardiovascular diseases is common in the ageing population. Whether this therapy exacerbates brain injury...mortality among patients under 45 years of age', but also as a growing disease in the ageing population of industrialized countries. Antiplatelet therapy is...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 744 ]
Napping.com – Getting the best out of sleep…
Updated:
(Feb 28, 2005)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Read More →24Jan 2017Helpful Meds for Aging Petsby Clara Adamsby jojoscope Our pets are...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 745 ]
Central Data Catalog
Updated:
(Aug 3, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Views: 23438 Citations: 1 Study on global ageing and adult health - 2006 2007 By: Dr...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 746 ]
SITECON
Updated:
(Jun 24, 2004)
Rate Avg:
(
no ratings
)
(
no ratings
)
...YY1 cMyc canonical p53ABL1 TRRD-ArtSite(AS00241)AG TRRD-ArtSite(AS00298)AHR2 ARNT TRRD-ArtSite...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 747 ]
WebCite query result
Updated:
(Dec 28, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Problem drinking Participants - inclusion criteria 1. Minimum ... of 18 2. Minimum drinking amount of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 748 ]
ISRCTN18174167
Updated:
(Sep 2, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...AHI) more than five Participant type Patient ... group Adult Gender Not Specified Target number...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 749 ]
ISRCTN - ISRCTN22073647: EUROACTION PLUS intensive smoking intervention (varenicline)
Updated:
(Jun 4, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...month3. Willing to make a quit attempt4. Aged 18 years of ... or older, but less than 80 years...attempt3. Men and women, 50 years of ... or older, but less than 80 years, either sex4. Either:4.1. Newly identified high multifactorial risk individuals: CVD risk equal or greater than 5% over 10 years (now or projected to ... 60 years), according to the HeartScore risk...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 750 ]
WebCite query result
Updated:
(Apr 24, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...study domain Psychosis Participants - inclusion criteria 1. Aged 18 - 65 years, either sex 2. Antipsychotic...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 751 ]
[Binary: neuronelab.unisa.it]
Updated:
(May 29, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...and development Imaging informatics Informatics for healthy aging Information extraction - Natural language processing Management of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 752 ]
WebCite query result
Updated:
(Apr 13, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...tumors of the central nervous system and aged between 15 and 39 at the time...central nervous system2. Twelve months post-diagnosis3. Aged 15 to 39 at diagnosis4. Rating fertility-related distress or sexual dysfunction Participant type Patient ... group Mixed Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 753 ]
trial data
Updated:
(Oct 22, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...participation when they: - Are 18 years of ... or older - Have mild to moderate depression...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 754 ]
Rust-Bio
Updated:
(Feb 2, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...sh in your terminal. Depending on the ... of your system, the registered CA certificates...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 755 ]
DRKS - Deutsches Register Klinischer Studien (German Clinical Trials Register)
Updated:
(Jun 6, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...criteriaInclusion CriteriaGender: Both, male and femaleMinimum ...: 18 YearsMaximum ...: 60 Yearsend of 1:1...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 756 ]
RKI - Homepage
Updated:
(Oct 3, 2008)
Rate Avg:
(
no ratings
)
(
no ratings
)
...man BeÂhaviour: "Public Health: This messÂ... must be herd" (7.3.2017) 2017 IHR...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Prioritisation of infectious diseases in public health--call for comments.
(Oct 2, 2008)
Prioritisation of infectious diseases in public health--call for comments.
(Oct 2, 2008)
[ 757 ]
?pid=000000000030142267
Updated:
(Aug 18, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...a product used by consumers of diverse ... and capability in a wide range of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 758 ]
CC3431
Updated:
(Jul 7, 2004)
Rate Avg:
(
no ratings
)
(
no ratings
)
...GQG 180sp|P57089|NADD_NEIMA QGD-----------SLHQTPRELHAWLGKSLQDGSVRILSAPMHNVSSTEIRR-----AG 176sp|Q9PBG5|NADD_XYLFA PGITLQTQLPPKMATVFNHRWVQDPATLRNTPHGHLWLLNQPPNPSSASKVRAAISAAAH 197sp|Q9HX21...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
A Bayesian method for identifying missing enzymes in predicted metabolic pathway databases.
(Jun 9, 2004)
A Bayesian method for identifying missing enzymes in predicted metabolic pathway databases.
(Jun 9, 2004)
[ 759 ]
WebCite query result
Updated:
(Oct 14, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Control program. Who can participate? Cannabis users aged 18 and above, either sex, and who...2015 Reason abandonedEligibilityParticipant inclusion criteria 1. Minimal ... 18, either sex2. At least once a week cannabis use in the past 30 days prior to study entry Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 760 ]
Central Data Catalog
Updated:
(Oct 30, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...1)Filter by Collection6Any Study on Global AGEing and Adult Health (SAGE) (8) SAGE Well...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Data resource profile: the World Health Organization Study on global AGEing and adult health (SAGE).
(Dec, 2012)
Data resource profile: the World Health Organization Study on global AGEing and adult health (SAGE).
(Dec, 2012)
[ 761 ]
WebCite query result
Updated:
(Dec 24, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Exclusion criteria: Children or adolescents (under the ... of 18 years). Studies that do not...treatment group, type of non-transplant treatment, ... (mean, standard deviation, median), male:female ratio...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 762 ]
ISRCTN - ISRCTN56342476: Feasibility of a guided workbook intervention for cancer patients
Updated:
(May 4, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...aimsEvery year, thousands of people of working ... are diagnosed with cancer. After they are...06/2017 Reason abandonedEligibilityParticipant inclusion criteria 1. Aged between 18 and 65 years2. Proficient in written and spoken English3. Diagnosis of breast, gynaecological, urological or bowel cancer4. Working at time of diagnosis Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 763 ]
WebCite query result
Updated:
(Dec 21, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Volunteers: YesCriteriaInclusion Criteria:be between the ages of 18-60 years oldbe a non...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 764 ]
Home - NHS Alliance : NHS Alliance
Updated:
(Jun 20, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...providing flu vaccination to reception and school ... childrenApril 13, 2017 Pharmacists in General Practice...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 765 ]
OMIA - Online Mendelian Inheritance in Animals
Updated:
(Aug 23, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...2016. Pubmed reference: 26662214. DOI: 10.1111/....12393. 2014 Dikmen, S., Khan, F.A., Huson...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 766 ]
ISRCTN39642997
Updated:
(Nov 8, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...during the study period Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 767 ]
ISRCTN66285945
Updated:
(Apr 4, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...without a walking aid Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 768 ]
My Lungs My Life | Patient Respiratory Self-Management Toolkit
Updated:
(May 7, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...alternativeNarrator: Fran BaileyAsthma can develop at any ..., including young children, adults or elderly people...film, many thousands of people of all ages in Scotland and the UK are living...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 769 ]
WebCite query result
Updated:
(Jul 30, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...HD2 for annual well visit18 years of ... or olderAble to read in EnglishExclusion Criteria...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Use of email and telephone prompts to increase self-monitoring in a web-based intervention: randomized controlled trial.
(Jul 27, 2012)
Use of email and telephone prompts to increase self-monitoring in a web-based intervention: randomized controlled trial.
(Jul 27, 2012)
[ 770 ]
11879
Updated:
(Feb 4, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Health EISSN 1660-4601 Published by MDPI AG, Basel, Switzerland RSS E-Mail Table of...ScienceVaccinesVeterinary SciencesVirusesVisionWater Subscribe © 1996-2017 MDPI AG (Basel, Switzerland) unless otherwise stated Back to
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 771 ]
WebCite query result
Updated:
(Aug 21, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
... BothAccepts Healthy Volunteers: NoCriteriaInclusion Criteria:...: More than 20 years of ... and under 70 years of ....BMI ≥ 25kg/m2Patients with metabolic syndrome...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 772 ]
WebCite query result
Updated:
(Dec 18, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...study & applied questionnaire:1 . Master data (T0) (..., sex) 2 Diagnoses - such as the diagnosis...criteriaInclusion CriteriaGender: Both, male and femaleMinimum ...: 18 YearsMaximum ...: 80 Yearsend of 1:1...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 773 ]
Canada Drug Pharmacy: Canadian Drugs - Online Canadian Pharmacies
Updated:
(Oct 11, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...drugs from Canada Drug Pharmacy regardless of ..., health, income, or employment! There are no...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 774 ]
ISRCTN17161961and
Updated:
(Nov 22, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...60 years4. Written consent Participant type Patient ... group Not Specified Gender Not Specified Target...Rohatiner A, Culligan D, Hunter A, Prentice AG, Milligan DW, A feasibility study of simultaneous...Gilkes A, Milligan DW, Goldstone AH, Prentice AG, Wheatley K, Linch DC, Gale RE, The...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 775 ]
ISRCTN - ISRCTN55259451: Managing cigarette cravings using the Physical over Smoking (PoS) App
Updated:
(Oct 23, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...short exercises, tailored to participants' information (gender, ... etc) and current status (place, mood and...inclusion criteria Adult smokers Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 776 ]
WebCite query result
Updated:
(Jun 14, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Physical Activity and Nutrition Intervention for Men aged 35-54 years.Update: Reason: ...two-armed randomised control trial for men aged 35-54 years. 261003 0 Update...to be included in the study.- Male- Aged 35-54 years- Own a mobile phone...criteria- Female- Outside of 35-54 year ... bracket- Without a mobile phone- Without regular...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 777 ]
ISRCTN - ISRCTN36621459: Fertility and sexuality following cancer
Updated:
(Apr 13, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...tumors of the central nervous system and aged between 15 and 39 at the time...central nervous system2. Twelve months post-diagnosis3. Aged 15 to 39 at diagnosis4. Rating fertility-related distress or sexual dysfunction Participant type Patient ... group Mixed Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 778 ]
ISRCTN93129502
Updated:
(May 26, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Neuropsychological assessments will be performed on patients aged between 3-16 years, pre-operatively and...not requiring deep hypothermic circulatory arrest2. Patients aged â¤17 years of agePrevious inclusion criteria:1. Female and male patients from birth upwards (there is no upper ... limit, per se)2. Treated at the...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 779 ]
ISRCTN - ISRCTN10205425: Feasibility of an Exercise Intervention in Patients with Venous Ulcers
Updated:
(Oct 8, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...willing to tolerate high compression4. Patient is aged =18 years Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 780 ]
ISRCTN81112701
Updated:
(Jul 16, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...advanced dry eye disease Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 781 ]
Rule-Based Mediation (RBM): CISBAN in silico
Updated:
(Jul 14, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...The Centre for Integrated Systems Biology of Ageing and Nutrition (CISBAN), has developed a semantic...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 782 ]
WebCite query result
Updated:
(Sep 13, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...persistent to moderate asthma (prevalent cases) 2. ... 18-50 years 3. Doctor's diagnosis of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 783 ]
WebCite query result
Updated:
(May 4, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...aimsEvery year, thousands of people of working ... are diagnosed with cancer. After they are...06/2017 Reason abandonedEligibilityParticipant inclusion criteria 1. Aged between 18 and 65 years2. Proficient in written and spoken English3. Diagnosis of breast, gynaecological, urological or bowel cancer4. Working at time of diagnosis Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 784 ]
WebCite query result
Updated:
(Jan 6, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Physical Activity and Nutrition Intervention for Men aged 35-54 years.Update: Reason: ...two-armed randomised control trial for men aged 35-54 years. 261003 0 Update...to be included in the study.- Male- Aged 35-54 years- Own a mobile phone...criteria- Female- Outside of 35-54 year ... bracket- Without a mobile phone- Without regular...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 785 ]
For the Elderly, Being Heard About Life’s End - The New York Times
Updated:
(Oct 11, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...85, strides ahead of people half her ... and plays a fast-paced game of...illnesses, not the inevitable erosion of advanced ....Slow medicine, which shares with hospice care...and not without debate, especially in an aging society.Many in their 80s and 90s...that experts agree are unsustainable as boomers ....Most of that money is spent at...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 786 ]
WebCite query result
Updated:
(Apr 4, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...without a walking aid Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 787 ]
WebCite query result
Updated:
(Jun 4, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...will be asked to report brief demographics (... group, gender, race/ethnicity, position). During clinic...careEligible patient participants (Inclusion):18 years of ... or olderDiagnosis of malignant diseasePlan to have...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 788 ]
WebCite query result
Updated:
(Jun 29, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...logitudinal cohort, the 45 and Up Study2. Aged 45 to 75 years at date of...NSW Health Services.Update: Reason:Minimum ...:45 YearsUpdate: Reason:Maximum ...:75 YearsUpdate: Reason:Gender:Both...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 789 ]
WebCite query result
Updated:
(Dec 9, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...80% of all women of child-bearing ... drink alcoholic beverages. Of the 200.000...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 790 ]
WebCite query result
Updated:
(Jan 27, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...BothAccepts Healthy Volunteers: YesCriteriaInclusion Criteria:Adults ... 20-55 inclusiveBMI between 25 and 35...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 791 ]
Official Mad Cow Disease Home Page
Updated:
(Feb 2, 2006)
Rate Avg:
(
no ratings
)
(
no ratings
)
...on way out Oct 30..nvCJD at ... 74 Oct 29..Inquiry=whitewash+hogwash Oct...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
The prion protein gene in humans revisited: lessons from a worldwide resequencing study.
(Feb, 2006)
The prion protein gene in humans revisited: lessons from a worldwide resequencing study.
(Feb, 2006)
[ 792 ]
WebCite query result
Updated:
(Sep 7, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...NoCriteriaInclusion Criteria:Resident of Ontario19 years of ... or overHave consumed alcohol in the one...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 793 ]
WebCite query result
Updated:
(Jan 8, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...total of 606 adults, 18 years of ... and older were recruited, screened, and consented...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 794 ]
WebCite query result
Updated:
(Oct 23, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...short exercises, tailored to participants' information (gender, ... etc) and current status (place, mood and...inclusion criteria Adult smokers Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 795 ]
Home Page | Foodfacts.com
Updated:
(Nov 21, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...every 13 children (under 18 years of ...) or roughly two in every classroom that...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 796 ]
WebCite query result
Updated:
(Jan 9, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...clinic in Adelaide 5 timesMinimum age18 YearsMaximum ... No limitGenderBoth males and femalesCan healthy volunteers...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 797 ]
WebCite query result
Updated:
(Mar 13, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...14-17 year olds (roughly high school aged youth). It is guided by Self Determination...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 798 ]
WebCite query result
Updated:
(May 26, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Neuropsychological assessments will be performed on patients aged between 3-16 years, pre-operatively and...not requiring deep hypothermic circulatory arrest2. Patients aged â¤17 years of agePrevious inclusion criteria:1. Female and male patients from birth upwards (there is no upper ... limit, per se)2. Treated at the...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 799 ]
WebCite query result
Updated:
(Jun 2, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...is not currently in the reservesbetween the ages of 18 and 34the ability to read...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 800 ]
Immunization Action Coalition (IAC): Vaccine Information for Health Care Professionals
Updated:
(Jun 26, 2009)
Rate Avg:
(
no ratings
)
(
no ratings
)
...vaccines for adults over 65 years of ....Visit the VOTW archive ...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 801 ]
ISRCTN62056259
Updated:
(Feb 17, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...ADHD) from 8 to 12 years of ...? The expectation is that playing the serious...be from 8 to 12 years of ....2. All children must have an official...communication with the investigators. Participant type Patient ... group Child Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 802 ]
A systematic review on the prevalence of group A Streptococcal infection in Africa
Updated:
(Aug 28, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...patient characteristics:o Other diseases/conditions?o ... and gendero Penicillin prophylaxis exposureRisk of bias...models to estimate trends by country and .... A trend analysis will also be conducted...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 803 ]
GXB: Published Sample Sets
Updated:
(Jun 27, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...sapiensSepsis Pediatric, Whole Blood ...103 Post-natal ... is a critical determinant of the neonatal...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 804 ]
ISRCTN45058713
Updated:
(Mar 18, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...awareness campaign is aimed at young people (aged 14 Â 30) in the south of...Intervention in psychosis Service. Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 805 ]
display_record.asp?ID=CRD42013005943
Updated:
(Aug 27, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...how) socio-economic status, gender, ethnicity and ... moderate the effect of the interventions To...physical activity behaviours.Participants/ populationPeople of all ages, in any setting (including NHS settings), and...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 806 ]
ISRCTN - ISRCTN22975026: Graded Exercise Therapy guided SElf-help Treatment for CFS/ME
Updated:
(Jun 9, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...5. Target Gender: Male & Female 6. Lower ... Limit 18 years Participant type Patient ... group Adult Gender Both Target number of...presence of a doctor3. Being under the ... of 184. Having active suicidal thoughts Recruitment...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 807 ]
WHO | Influenza vaccines
Updated:
(Sep 20, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...coordinated manner by the influenza stakeholders.GAP AG report to the WHO Director-Generalpdf, 200kb16...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 808 ]
WebCite query result
Updated:
(Jan 9, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...03/2010 Reason abandonedEligibilityParticipant inclusion criteria 1. Aged 18 - 65 years, either sex2. Evidence of psychological distress determined through screening questionnaire3. Access to the internet at home4. Willingness to participate in the trial Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 809 ]
ISRCTN82208287
Updated:
(Sep 15, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...common finding and is increasingly common with .... It has been suggested that about 50...can participate? Patients with acute diverticulitis (no ... limits, either sex).What does the study...criteria 1. Patients with acute diverticulitis (no ... limits, either sex)2. Intra-abdominal fluid...withdraw the presumed consent. Participant type Patient ... group Other Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 810 ]
About ARVD (Arrhythmogenic right ventricular dysplasia)
Updated:
(Nov 14, 2005)
Rate Avg:
(
no ratings
)
(
no ratings
)
...be suspected in a young or middle aged person who has ventricular arrhythmias with left...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 811 ]
TopoICSim
Updated:
(Jul 30, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...needed.") if (species == "anopheles") if(!requireNamespace("org.Ag.eg.db")) stop("The package org.Ag.eg.db is needed.") if (species == "ecsakai...ecolik12 = "EcK12", bovine = "Bt", canine = "Cf", anopheles = "Ag", ecsakai = "EcSakai", chicken = "Gg", chimp = "Pt", malaria...eg.db::org.Cf.egGO, anopheles = org.Ag.eg.db::org.Ag.egGO, ecsakai = org.EcSakai.eg.db::org...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 812 ]
sSMC 19
Updated:
(Dec 6, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
... case no. gender/ ... at diagnosisstudied materialde novo/ inheritedGTG-banding result grade of mosaicismfinal result of the sSMCtest...data: RP11-22G10 (22.98MB) on sSMCcenM; subcenM, UPD-testAmniocentesis due to advanced maternal ...; normal child, APGAR 9/10/10; weight 3720g, length 54 cm; OFC 35.5 cm...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Selective cognitive impairment and tall stature due to chromosome 19 supernumerary ring.
(Jan, 2012)
Selective cognitive impairment and tall stature due to chromosome 19 supernumerary ring.
(Jan, 2012)
[ 813 ]
trial data
Updated:
(Apr 1, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...and unprovoked PE are eligible.- Exclusion criteria1. ... less than 18 years; 2. Acute onset...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 814 ]
Resources for Dermatology and Visual Conditions | skinsight
Updated:
(Nov 8, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...lobster? Historical features of importance include the ... of the patient, the speed or timing...the differential diagnostic process by using an ... and body location diagnostic approach, try the...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Effects on skills and practice from a web-based skin cancer course for primary care providers.
(Nov, 2013)
Effects on skills and practice from a web-based skin cancer course for primary care providers.
(Nov, 2013)
[ 815 ]
WebCite query result
Updated:
(Mar 10, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Exclusion criteria: Children or adolescents (under the ... of 18 years). Studies that do not...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 816 ]
Copernicus.org - About us
Updated:
(Jul 11, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Declaration on knowledge discovery in the digital .... Copernicus celebrates 15 years of interactive open...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 817 ]
WebCite query result
Updated:
(Mar 10, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Exclusion criteria: Children or adolescents (under the ... of 18 years). Studies that do not...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 818 ]
WebCite query result
Updated:
(Jan 6, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...five years with at least one child aged between 8-18. People in a recruitment...five years2. One child in every family, aged 8-18 years old, living with a...Living nearby the family Participant type Mixed ... group Mixed Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 819 ]
WebCite query result
Updated:
(Nov 5, 2008)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Criteria:patients who were 18 years of ... and younger Contacts and LocationsPlease refer to...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Internet delivered support for tobacco control in dental practice: randomized controlled trial.
(Nov 4, 2008)
Internet delivered support for tobacco control in dental practice: randomized controlled trial.
(Nov 4, 2008)
[ 820 ]
EXALIN — mRNA to genomic alignment
Updated:
(Jan 4, 2006)
Rate Avg:
(
no ratings
)
(
no ratings
)
...even between multiple instances of canonical GT..AG splice junctions due to differences present at...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Improved spliced alignment from an information theoretic approach.
(Jan 1, 2006)
Improved spliced alignment from an information theoretic approach.
(Jan 1, 2006)
[ 821 ]
WebCite query result
Updated:
(Jun 26, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
... BothAccepts Healthy Volunteers: NoCriteriaInclusion Criteria:Aged 14 - 24 years of ageProficient EnglishPatients must...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 822 ]
WebCite query result
Updated:
(Dec 24, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Exclusion criteria: Children or adolescents (under the ... of 18 years). Studies that do not...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 823 ]
ISRCTN98176068
Updated:
(Mar 31, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...2012 Reason abandonedEligibilityParticipant inclusion criteria 1. Adults, aged 18 or older2. Self-reported BMI >233. UK resident4. Able to access the internet on a regular basis 5. Able and willing to weigh self once per week Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 824 ]
WebCite query result
Updated:
(Feb 17, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...ADHD) from 8 to 12 years of ...? The expectation is that playing the serious...be from 8 to 12 years of ....2. All children must have an official...communication with the investigators. Participant type Patient ... group Child Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 825 ]
WebCite query result
Updated:
(Jun 14, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...08/2013 Reason abandonedEligibilityParticipant inclusion criteria 1. ... 18 years or older2. Managing asthma with a metered dose inhaler (preventer)3. Able to access a device (laptop, desktop, or smartphone) with an internet connection at least once per week Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 826 ]
WebCite query result
Updated:
(Jan 30, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...female adolescents, HPV vaccine coverage among adolescents ... 13-17 is poor (60% for girls...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 827 ]
WebCite query result
Updated:
(Aug 14, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Medical Centre (VUMC) in Amsterdam, Netherlands 2. Aged 18 years and older 3. Proficiency in...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 828 ]
WebCite query result
Updated:
(Mar 10, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Exclusion criteria: Children or adolescents (under the ... of 18 years). Studies that do not...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 829 ]
mGene.web: A Web Service for Accurate Computational Gene Finding — Raetsch-Lab
Updated:
(Jun 30, 2009)
Rate Avg:
(
no ratings
)
(
no ratings
)
...mixed states, namely AccTis with the consensus AG|ATG and AccStop with a consensus GT...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 830 ]
WebCite query result
Updated:
(Mar 10, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Exclusion criteria: Children or adolescents (under the ... of 18 years). Studies that do not...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 831 ]
WebCite query result
Updated:
(Aug 9, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...prostate cancer Participants - inclusion criteria Men between ages of 50 and 75 Participants - exclusion criteria...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 832 ]
WebCite query result
Updated:
(Nov 10, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...users 2. Internet access 3. Over the ... of 18 4. Would like to engage...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 833 ]
WebCite query result
Updated:
(Apr 2, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...to participation and gives informed consentExclusion Criteria:... ...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 834 ]
WebCite query result
Updated:
(May 28, 2010)
Rate Avg:
(
no ratings
)
(
no ratings
)
...prostate cancer Participants - inclusion criteria Men between ages of 50 and 75 Participants - exclusion criteria...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Supporting informed decision making online in 20 minutes: an observational web-log study of a PSA test decision aid.
(May 26, 2010)
Supporting informed decision making online in 20 minutes: an observational web-log study of a PSA test decision aid.
(May 26, 2010)
[ 835 ]
ISRCTN - ISRCTN33301739: Cochlear implantation in patients with single-sided deafness
Updated:
(Aug 25, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...will be at least 18 years of ... at the time of entering the study...abandonedEligibilityParticipant inclusion criteria 1. 18 years of ... or older at the time of entry...and 2000 HzTarget Gender: Male & Female ; Lower ... Limit 18 years Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 836 ]
WebCite query result
Updated:
(Jan 23, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
... BothAccepts Healthy Volunteers: NoCriteriaInclusion Criteria:... 18 or overEnglish-speakingReports injection of illicit...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 837 ]
Cortactin promotes exosome secretion by controlling branched actin dynamics | JCB
Updated:
(Jul 19, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...miR-214 to secrete exosomes that suppress senescence and induce angiogenesis in human and mouse...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 838 ]
ISRCTN68128332
Updated:
(Jan 30, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...in Durban, KwaZulu-Natal Participant type Patient ... group Adult Gender Female Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 839 ]
WebCite query result
Updated:
(May 7, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...of adding IVR call?• Stratify by: ..., race, gender, flu vaccine last year (y...of adding IVR call?• Stratify by: ..., race, gender, pneumo vaccine last year & level...NoCriteriaInclusion Criteria:RMG Patients 18 years of ... or older.Overdue for vaccination against influenza...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 840 ]
lipid.biocuckoo.org
Updated:
(Jun 16, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...applied the Particle Swarm Optimization with an aging leader and challengers (ALC-PSO) (Chen et...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 841 ]
151
Updated:
(Aug 5, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...with ICU mortality, and performed better than ... >32 years, anisocoria at admission, and basal...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 842 ]
WebCite query result
Updated:
(Mar 30, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Participants are stratified according to participating site, ... (55 years and over vs under 55...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 843 ]
WebCite query result
Updated:
(Oct 14, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...guardians of children with FASD between the ages of 4-12 years, that is based...and CBCL/6-18) to accommodate the ... range of the sampleSecondary Outcome Measures: A...a child between 4-12 years of ... with a diagnosis which falls under the...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 844 ]
WebCite query result
Updated:
(Apr 23, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...levels of stress are not moderated by ..., gender or educational levels. Lay summary Background...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 845 ]
Inicio - Pediamécum Pediamécum
Updated:
(Oct 1, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...2017 10:52:30News Medical | Study finds ...-related decline in children's physical activity levelsEstos...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 846 ]
Homepage - Surgical Infection Society Member Portal
Updated:
(Apr 24, 2006)
Rate Avg:
(
no ratings
)
(
no ratings
)
...to educate them on Frailty Among the Aged in Canada, under the theme of biology...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Defining the research agenda for surgical infection: a consensus of experts using the Delphi approach.
(Apr, 2006)
Defining the research agenda for surgical infection: a consensus of experts using the Delphi approach.
(Apr, 2006)
[ 847 ]
The epidemiology of dengue disease in Brazil: literature analysis and review
Updated:
(Jan 3, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Dengue disease. No limits by sex or .... Inclusion of both indigenous and non-indigenous...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 848 ]
ISRCTN59207794
Updated:
(Feb 24, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...can participate?Male and female Arab students, aged 18 years and older, who are attending...years and older Participant type Healthy volunteer ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 849 ]
StemBook
Updated:
(Mar 21, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...all Chapters in Section »Renewal »Aging and stem cell renewalQuiescent stem cells in...of questions including differentiation, the niche, and aging. Allan recently spoke with StemBook editor, Lisa...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Building biomedical web communities using a semantically aware content management system.
(Mar, 2009)
Building biomedical web communities using a semantically aware content management system.
(Mar, 2009)
[ 850 ]
DRKS - Deutsches Register Klinischer Studien (German Clinical Trials Register)
Updated:
(Jun 30, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...criteriaInclusion CriteriaGender: Both, male and femaleMinimum ...: 18 YearsMaximum ...: no maximum ageend of 1:1...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 851 ]
WebCite query result
Updated:
(Jun 18, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
... BothAccepts Healthy Volunteers: NoCriteriaInclusion Criteria:... > 18 yearsCapability of filling in questionnaires in...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 852 ]
WebCite query result
Updated:
(Aug 14, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...in the Canton Ticino (Switzerland).CriteriaInclusion Criteria:aged > 18 years,having suffered from back pain...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 853 ]
Welcome to SRAMP, an online m6A site predictor
Updated:
(Jun 3, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...on the DRACH motif (i.e. [AGU][AG]AC[ACU] in regular expression style). Nevertheless...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 854 ]
WebCite query result
Updated:
(Jan 20, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...åï¼ Inclusion criteria (1) aged 18 or above, (2) no concurrent diagnosis...Participant ageï¼ æå° Min ... 18 å² yearsæ大 Max ... 60 å² years éæºæ...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 855 ]
display_record.asp?ID=CRD42012002341
Updated:
(Nov 7, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Dengue disease. No limits by sex or .... Inclusion of both indigenous and non-indigenous...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 856 ]
mome-clic.com
Updated:
(Oct 21, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...morphometric outline methods in the discrimination of ...-related differences in feather shape3D images of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 857 ]
WebCite query result
Updated:
(Mar 11, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...excluded men and women ...; who did not have access to a...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 858 ]
ISRCTN07752711
Updated:
(Dec 26, 2011)
Rate Avg:
(
no ratings
)
(
no ratings
)
...on a previous angiogram Participant type Patient ... group Adult Gender Both Target number of...Tijssen JG, de Winter RJ, Effects of ... on long-term outcomes after a routine...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 859 ]
BMC Medicine | Article collections | Spotlight on prostate cancer
Updated:
(Apr 10, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...cancer are not fully understood, but older ..., family history of the disease and African...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 860 ]
WPRO | Noncommunicable diseases
Updated:
(Aug 14, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...from NCDs (deaths before 70 years of ...): they account for 50% of such deaths...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 861 ]
CLADE domain annotation tool
Updated:
(Jul 30, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...architectures, and the estimation of protein domain .... DownloadThe CLADE package can be downloaded...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 862 ]
Cafepharma | Pharmaceutical Sales, Medical Sales, Lab Sales
Updated:
(Sep 6, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Infrastructure for Outcomes-based ContractsDrug ChannelsThe New ... of BioDigital Pharmapharmexec technologyThe New ... of BioDigital Pharmapharmexec technologyA Clinical Trial Torpedoed...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 863 ]
WebCite query result
Updated:
(Jul 23, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...the study. Our criteria are: 1. Similar ... 2. Able to understand and follow commands 3. Willing to participate and able to tolerate the dance activity (1 hour session, twice a week for 10 weeks with practice) 4. Target Gender: Male & Female; Upper ... Limit 99 years ; Lower ... Limit 18 years Participants - exclusion criteria Parkinson...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 864 ]
Nurse suspended for offering to pray for patient's recovery - Telegraph
Updated:
(Sep 24, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...BT engineer and they have two sons, aged 14 and ten. The couple attend Milton... Living proof: the secret of healthy ageing Why olive oil should be kept...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 865 ]
?doi=446272
Updated:
(Aug 24, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...com/?doi=446272.© 2016 S. Karger AG, BaselArticle / Publication DetailsFirst-Page Preview Received: October...Cappuccino with Claudio Ronco© 2017 S. Karger AG, Basel Karger International: COM | DE | CNSwitch to...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 866 ]
WebCite query result
Updated:
(Feb 19, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Physical inactivity- Inclusion criteriaParticipants will be adults, aged between 20 and 65. Participants will be...behaviour. Study population: Participants will be adults, aged between 20 and 65. Participants will be...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 867 ]
ISRCTN43070564
Updated:
(Jul 23, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...than 3 months ago) Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 868 ]
ISRCTN39656144
Updated:
(Jun 22, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...connection3. Are internet-literate Participant type Patient ... group Adult Gender Female Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 869 ]
WebCite query result
Updated:
(May 14, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...they are currently under 18 years of ... or are currently receiving treatment for depression...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 870 ]
WebCite query result
Updated:
(Feb 24, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...can participate?Male and female Arab students, aged 18 years and older, who are attending...18 years and older Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 871 ]
ISRCTN15747108
Updated:
(Feb 12, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...individuals with type 2 diabetes. The mean ... of participants was 58.9 years (SD...the study registration process. Participant type Patient ... group Adult Gender Both Target number of participants At least 204 Participant exclusion criteria 1. Not being a member of the Diabète Québec newsletter.2. Not being between 18 and 65 years of .... Recruitment start date 15/09/2014 Recruitment...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 872 ]
ISRCTN61630192
Updated:
(May 7, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...elective laparoscopic cholecystectomy operation Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 873 ]
WebCite query result
Updated:
(Dec 24, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Exclusion criteria: Children or adolescents (under the ... of 18 years). Studies that don't report...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 874 ]
000446856
Updated:
(Jun 16, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...10.1159/000446856).© 2016 S. Karger AG, BaselArticle / Publication DetailsFirst-Page Preview Published online...next Recommend this © 2017 S. Karger AG, Basel Karger International: COM | DE | CNSwitch to...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 875 ]
Springer - International Publisher Science, Technology, Medicine
Updated:
(Feb 8, 2005)
Rate Avg:
(
no ratings
)
(
no ratings
)
...³ãLegal© 2017 Springer International Publishing AG. Part of Springer Nature Privacy PolicyGeneral Terms...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 876 ]
WebCite query result
Updated:
(Nov 21, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...blood pressure control are needed.Participants/ populationAdults (aged 18 or over) with a diagnosis of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 877 ]
www.artscouncil.ie
Updated:
(May 20, 2015)
Rate Avg:
(
no ratings
)
(
no ratings
)
...Rock USAThe Civic Theatre, Dublin (4 May)... Connolly & Pat ReedyBalor Arts Centre, Donegal (4...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 878 ]
Cranial Nonmetric Trait Database | Queen's University Library
Updated:
(Nov 11, 2013)
Rate Avg:
(
no ratings
)
(
no ratings
)
...i.e. patterns of variation according to ..., sex, side and population, as well as...No.3 (June 2006): 537-548.Kozintsev, A.G. 1992. Ethnic Epigenetics: a New Approach. Homo...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
Brief communication: Cranial nonmetric trait database on the internet.
(Dec, 2013)
Brief communication: Cranial nonmetric trait database on the internet.
(Dec, 2013)
[ 879 ]
WebCite query result
Updated:
(Feb 12, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...individuals with type 2 diabetes. The mean ... of participants was 58.9 years (SD...the study registration process. Participant type Patient ... group Adult Gender Both Target number of participants At least 204 Participant exclusion criteria 1. Not being a member of the Diabète Québec newsletter.2. Not being between 18 and 65 years of .... Recruitment start date 15/09/2014 Recruitment...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 880 ]
Prosthetic heart valves in pregnancy: a systematic review and meta-analysis protocol
Updated:
(Feb 5, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...weeks of gestation b. Small for gestational ... (SGA) Less than tenth birth weight percentile for sex and gestational ... c. Low birth weight (LBW) Birth weight...Number of participants, number of pregnancies, maternal ..., parity Heart valve characteristics: Number of mechanical...which pregnancies occur and population characteristics (ethnicity, ... range, aetiology of underlying disease, type and...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 881 ]
ISRCTN05886349
Updated:
(Jun 4, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...than 3 mm diameter Participant type Patient ... group Not Specified Gender Not Specified Target...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 882 ]
ISRCTN75836930
Updated:
(Aug 12, 2014)
Rate Avg:
(
no ratings
)
(
no ratings
)
...participate? Patients must be 18 years of ... or over with severe aortic stenosis. What...device7. Written informed consent Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 883 ]
National Ag Safety Database - National Ag Safety Database
Updated:
(Sep 21, 2012)
Rate Avg:
(
no ratings
)
(
no ratings
)
...html text/html; charset=utf-8 National Ag Safety Database - National Ag Safety Database TopicsTrainingTopicsTrainingNiosh Ag CentersRecent AdditionsAbout NASDContactFeedbackDisclaimerRollover Protection for Farm Tractor...and harassment against any person because of ..., ancestry color, disability or handicap, national origin...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 884 ]
WebCite query result
Updated:
(Nov 30, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...now the most common cancer in women aged 25-29. To reduce melanoma morbidity and...with their mothers begin at an earlier ..., become more habitual tanners, and are more...that enrolls mothers and adolescent teen daughters aged 14 to 17 years old. Participants will...Criteria (Mothers):Live in TennesseeHave a daughter aged 14 to 17Register for the social media campaignConsent to participateRead EnglishComplete the online baseline surveyDaughter provides assent to participateHave a Facebook account or be willing to create oneExclusion Criteria (Mothers):Not reading EnglishLiving outside TennesseeDaughter not assenting to participateInclusion Criteria (Daughters)... 14-17Provide assent for mother to...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 885 ]
WebCite query result
Updated:
(Jan 30, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...to 10% of all youth by the ... of 16. Anxiety disorders can have serious...a computer to interact with web materialyouth aged 13-14 must have a consenting parentExclusion...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
[ 886 ]
WebCite query result
Updated:
(Jan 15, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...for musculoskeletal or neurological conditionsMinimum age60 YearsMaximum ... No limitGenderBoth males and femalesCan healthy volunteers...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
[ 887 ]
ISRCTN - ISRCTN79584912: Treating trauma in psychosis
Updated:
(Sep 18, 2016)
Rate Avg:
(
no ratings
)
(
no ratings
)
...MINI2. PTSD as assessed by CAPS3. Outpatient4. ... 18 to 65 years Participant type Patient ... group Adult Gender Both Target number of...
MeSH:
Pages linking to this site found by ... Help
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
Google Yahoo
Papers citing this site found by ... Help
BioMed Central Scirus HighWire Press Google Scholar
PubMed entry(s) Help
